(data stored in ACNUC7421 zone)

EMBL: CP001622.PE294

CP001622.PE294       Location/Qualifiers
FT   CDS_pept        304570..305724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0295"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG: thuBf;
FT                   myo-inositol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54606"
FT                   /db_xref="GOA:C6B0I7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I7"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACS54606.1"
FT                   /translation="MTKIFRFGVIGCGLMGREFASAAARWLHLADVKARPEIVAVCDTN
FT                   ATLLDWFRDHVPTVRQFAADYKELLANPEVDAVYCAVPHVLHQQFYIDVLKAGKHLLGE
FT                   KPFGMDAAQNRDIMAVLAEHPELLVRCSSEMPFFPGAQKVIALAKSGEMGDIIEVEAGF
FT                   LHSSDIDRQKPINWKRMADINGDYGCMGDLGMHVLHVPLRLGWRPTTLHAQLVKKVTER
FT                   PDGKGGMLPCTTWDNATISSRVRTGDQDFPMVLKTWRIAPGESNTWYLRVLGMKKSAFF
FT                   STKSPRQWQWMDYNGGVQAWSTEDLGYGSLFPAITGKIFEFGFADAIQQMWAAFVDELV
FT                   GGNANGFGCATPAEAQAHHAVLTAALKSGLEDVVIPVEYDGASA"
     atgacgaaaa tattccgctt cggcgtcatc ggctgcggtc tgatggggcg cgaattcgcg        60
     agtgctgcgg cgcgctggct gcatctggcc gatgtgaagg cgcgaccgga aatcgtcgcc       120
     gtctgtgata ccaacgcgac gctgctcgac tggttcaggg atcatgtgcc gaccgttcgg       180
     cagttcgccg ccgactataa ggagcttctg gccaatcccg aggtcgatgc ggtctattgc       240
     gctgtcccgc atgtgctgca ccagcaattc tacatcgacg tcctgaaggc cggaaaacat       300
     cttctcggcg aaaagccctt cggcatggac gccgcgcaga accgggatat catggctgtt       360
     ctcgccgagc atcccgaact cctggtccgc tgctcgtcgg aaatgccttt cttccccggc       420
     gcgcagaagg tcatcgcgct cgcaaaaagt ggcgagatgg gggatataat cgaagtcgag       480
     gcgggtttcc tgcactcttc ggatatcgac cggcagaagc cgatcaactg gaagcgcatg       540
     gccgatatca atggcgatta tggctgcatg ggtgatctcg gcatgcatgt gctgcacgtg       600
     ccgctgcgtc tcggctggcg cccgacgacc ctgcatgcgc aattggtcaa gaaggtcacc       660
     gaacgtcctg acggcaaggg cggcatgttg ccctgcacca cctgggacaa tgctacgatc       720
     agcagccgcg tgcgcaccgg cgatcaggat ttcccgatgg tgctgaaaac ctggcgcatc       780
     gcgcccggcg aatccaacac ctggtacctc cgcgttctcg gcatgaagaa gagcgcgttc       840
     ttcagcacga agtcgccgcg ccaatggcag tggatggact ataatggcgg tgtccaggct       900
     tggagcaccg aggatctcgg ttatggctcg ctgtttccag ccataacagg caagatcttc       960
     gaattcggtt ttgccgacgc catacagcag atgtgggcgg ccttcgtcga tgagcttgtt      1020
     ggaggaaatg ccaacggttt cggctgcgcg acgccggccg aggcgcaggc gcatcatgcg      1080
     gtcctgacgg cagccctcaa atccggcctc gaggacgtcg tgataccggt cgagtatgac      1140
     ggggcgtcag cctga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page