(data stored in ACNUC7421 zone)

EMBL: CP001622.PE295

CP001622.PE295       Location/Qualifiers
FT   CDS_pept        305724..306395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0296"
FT                   /product="protein of unknown function DUF1498"
FT                   /note="PFAM: protein of unknown function DUF1498; KEGG:
FT                   hypothetical protein; K09988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54607"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I8"
FT                   /inference="protein motif:PFAM:PF07385"
FT                   /protein_id="ACS54607.1"
FT                   /translation="MKRSEINAALLRATETLERWHWSLPAWGSWTAADFAAHPEASAYL
FT                   RAHQLGWDVTDFGSNRFAECGLVLFSLRNGVVDIRGERTYAEKLLFVGEGQVTPTHRHA
FT                   AKMEDIINRAGGDLVIEFAATDADGNVLAEDVTVPVDGLQHRLAAWEPLVLQPGQSVTI
FT                   RTGLYHRFYGRKGGGPVLVGEVSQVNDDNSDNFFLEPIARFAAIEEDEPPLRPLWNEGV
FT                   S"
     atgaagcgct ccgagatcaa cgccgcgttg ctgcgggcaa ccgagaccct cgagcgctgg        60
     cactggtctc tgccggcatg gggctcctgg acggcggccg attttgccgc tcatcctgag       120
     gcatcagcct atttgcgcgc ccatcagctg ggttgggatg tcaccgattt cggctcgaac       180
     cgcttcgccg aatgcggtct cgtgctgttt agcctgcgca atggcgtcgt cgatatcagg       240
     ggtgaacgga cctatgccga aaagctgctc ttcgttgggg aagggcaggt tacgccgacc       300
     caccgtcatg cggcgaagat ggaagacatc atcaatcgcg ccggcggcga tctcgtcatc       360
     gaattcgccg caaccgatgc cgatggcaat gtgctggcgg aggatgtgac ggtgccggta       420
     gacgggctgc agcaccggct cgccgcatgg gagccgctgg ttctccagcc cggccagagc       480
     gtgacgatcc gcaccgggct ttaccaccgc ttctacggca ggaaaggcgg cggacctgtc       540
     cttgtcggcg aggtcagcca ggtcaacgac gacaacagcg acaatttctt tctggagccg       600
     atcgcgcgct ttgccgcgat cgaggaagac gagccgccgc tgagaccctt gtggaacgaa       660
     ggagtcagct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page