(data stored in ACNUC7421 zone)

EMBL: CP001622.PE296

CP001622.PE296       Location/Qualifiers
FT   CDS_pept        306395..307453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0297"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: iolC; myo-inositol
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54608"
FT                   /db_xref="GOA:C6B0I9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I9"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54608.1"
FT                   /translation="MRAGEEVHDRDSQKQGGIVCAGNFIVDRVHTLSYWPEQGNLAHIL
FT                   HQDLGVGGGAANVVTDLASLGFPGKLAAAGCIGADQDGEIVKARLAVAGVDVVGLTALA
FT                   DRVTAHTHVMNVPGQNRTFFYHGGANDAVTDELVSPAAFAKAGYRLFYLGYLMLLPGLD
FT                   RIGPDGRSGASRLLEAARRAGLTTCVDFVSSEDPEFAAKVGVALPFCDYLIINEMEAGR
FT                   ATGVIVRDAEGDLTEAGLLEAGERLLAAGVSKGAIIHAPETCFWFSPGASPIMTRSRPV
FT                   DPDDIVSTVGAGDAFCAAVLYGLHENWPVEHICAVAHAAAARCLKGATATDGIPDMSVL
FT                   IREAKETNPQSA"
     atgcgagccg gggaggaggt tcacgatcgc gacagtcaaa agcagggcgg catcgtttgc        60
     gccggaaact tcatcgtcga tcgcgtccac accctgtctt attggcccga acagggcaat       120
     ctcgcccata tcctgcacca ggatctgggt gtggggggcg gggcggccaa tgtcgtcacc       180
     gatctggctt cgcttggatt tcccggaaaa ctggcggcgg cgggatgcat cggcgccgat       240
     caggacggag agatcgtcaa ggcccgcctt gcggttgccg gcgtcgatgt cgtggggctc       300
     accgcgcttg ccgaccgggt gacggcgcat acgcatgtca tgaatgtgcc cggccagaac       360
     cggaccttct tctatcatgg tggcgccaac gatgccgtca cggatgagct tgtctcaccc       420
     gcagccttcg ccaaggccgg ctatcggctg ttctatctcg gctatctcat gctgttgccg       480
     ggtctcgacc gcattggccc cgacggccgt tcgggagcat cgcgcctgct ggaagcggcg       540
     cggcgcgccg gcctgacgac ctgcgtggat ttcgtatcga gcgaagaccc ggaatttgcg       600
     gccaaggtcg gcgtcgctct gccattctgc gattatctga tcatcaacga gatggaggcg       660
     ggacgggcaa ccggcgttat cgttcgcgat gcggagggag atttgaccga ggcggggctt       720
     ttggaagcgg gggagcgcct tcttgcggcc ggcgtctcca agggcgcgat catccatgcg       780
     ccggaaacct gcttctggtt ttcgcccggc gcttctccga tcatgacgcg ttcacgaccc       840
     gtcgatcccg atgacatcgt cagtaccgtc ggcgcaggag acgctttctg cgccgccgtg       900
     ctctacggcc tgcatgagaa ctggccggtc gagcatatct gcgccgtcgc ccatgccgca       960
     gctgcgcgtt gcctcaaggg ggcgacggcc accgatggca tccccgacat gtctgtcctt      1020
     attcgcgagg cgaaggagac gaacccgcaa tccgcttag                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page