(data stored in ACNUC7421 zone)

EMBL: CP001622.PE297

CP001622.PE297       Location/Qualifiers
FT   CDS_pept        307589..308377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0298"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   smoS; sorbitol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54609"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54609.1"
FT                   /translation="MTHTETARLSGKVALVTGGASGIGKAVCQRFAAEGARVVVADLDG
FT                   ERCARVAEAIGPDVWGAALDVTRQDSIEEAVRFTISTAGQIDILVNAAGIYDVESILEI
FT                   SRERTARVFQVNIEGLIFMTQAVARHMVERGEGGRIINFSSQAGRRGEGPAVAYCASKA
FT                   AVISITQSCALELIRYGINVNAIAPGVVDTPMWDVVDAKLGSREGLRPGDVKRRVAAAV
FT                   PAGRFGAPQEQAAMAAFLAGPDAAYIVAQCYNVDGGNVMS"
     atgacccata cggaaacggc gcggctctcc ggcaaggtgg cattggttac aggaggagcg        60
     agcggcatcg gcaaggcggt atgccaacgc ttcgctgccg aaggcgcgag ggttgtcgtg       120
     gcggacctcg acggtgaacg atgcgcacgg gtggcggaag cgatcggccc tgatgtctgg       180
     ggtgcagcgc ttgacgtgac ccgccaggac agcatcgaag aagccgtacg cttcactata       240
     tcaaccgccg gtcagatcga catcctggtc aacgccgcag gcatttacga cgtcgagtcc       300
     atcctggaaa tatcccggga acggaccgct agggtatttc aggtcaatat cgaaggcctg       360
     atcttcatga cgcaggccgt tgcccggcac atggtggaaa gaggggaagg tggacgcatc       420
     atcaacttct cgtcccaggc tgggcgccgg ggcgaaggac cggccgtggc ttactgcgct       480
     tccaaggcgg ccgtcatcag catcacccaa agctgcgctc tggagctgat ccgttacggg       540
     atcaacgtca acgccatcgc tcccggcgtc gtcgatacgc cgatgtggga cgtcgtcgat       600
     gcaaaactcg gcagccggga aggtttgaga cccggtgacg tcaagcgccg cgtggccgcc       660
     gccgtcccgg ccggacgatt tggcgccccc caagaacaag ctgccatggc cgccttcctg       720
     gccggacccg atgcagcata catcgtggcg cagtgctaca atgtcgacgg cggcaatgtc       780
     atgagctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page