(data stored in ACNUC7421 zone)

EMBL: CP001622.PE298

CP001622.PE298       Location/Qualifiers
FT   CDS_pept        308435..309445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0299"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   L-iditol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54610"
FT                   /db_xref="GOA:C6B0J1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J1"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACS54610.1"
FT                   /translation="MRAVRLESIGSLTMRSVERPVAGPGELLVRVAVAGICGSDRHMYK
FT                   GEYPTAIPVTLGHELCGIVEAIGDTVTRFTGGELVTVDPNIACGTCRACTQARPNLCES
FT                   LTAIGVTRDGGFAEYVAVPQAQAFVLPAGLDPVHGAFSEPLACCIHAIDKARIRPGDSV
FT                   AILGGGVIGLLMVQLARLAGAGEIILITRQQSRRQTALRLGATHAFDPTSSDTIASVRE
FT                   VTKGGADVVIECAGVSDTLQSGLKMARRGGTFVLFGVTPAGVEVPVLPFDLLVNEVDIR
FT                   PAYLNPFTHSRAAAMVASGVLELDALVTKTISLEEVADVVGNAPLPGEIKVIVRP"
     atgagagctg tacgtttgga gtcgatcggg tctttgacca tgcgcagcgt cgagaggccg        60
     gttgccggac cgggcgagct gcttgtccgg gttgcagtgg ccggcatctg tggttccgat       120
     cgccacatgt acaagggcga gtatccgacg gctatccccg tcacgctggg ccacgaattg       180
     tgcggcatag tggaagcgat cggcgatacc gttacccgct ttaccggtgg tgagcttgtg       240
     acggtggacc cgaatattgc ctgcggcacc tgtcgggcgt gcacgcaggc gcggccgaac       300
     ttgtgcgaga gcttgaccgc catcggtgtg acacgggatg gcggctttgc cgaatatgta       360
     gcggtgccgc aggcccaggc cttcgtcctg cctgccggcc tcgatcccgt tcacggcgcc       420
     ttcagtgaac cgctggcctg ctgtattcac gccatcgaca aggcaaggat ccgtccgggc       480
     gacagcgtcg cgatcctcgg cgggggcgtg atcggcctgc tcatggtgca actggcccgc       540
     ctggctgggg caggcgagat tattttgatt acgcggcagc aatcgagacg ccaaaccgct       600
     ctgcgcctgg gggcgacgca cgccttcgac ccgacctctt cagacacaat cgcttccgtt       660
     cgagaggtca ccaaaggcgg cgccgacgtt gtcatcgagt gcgccggcgt cagcgacacg       720
     cttcaaagcg gtctgaagat ggcgcggcgc ggtggtacct tcgtgctttt tggggtcaca       780
     ccggcgggtg tcgaggtgcc ggttctgcct ttcgatctgc tcgtaaacga agtcgatatc       840
     aggccggcct acctcaaccc cttcacccat tcgcgcgctg cggcaatggt cgcgagcgga       900
     gtgttggagc tggacgcatt ggtcaccaaa accataagtc tcgaggaggt cgccgacgtg       960
     gtgggcaacg cgccattgcc gggcgagatc aaggtcatcg tccggcccta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page