(data stored in ACNUC7421 zone)

EMBL: CP001622.PE299

CP001622.PE299       Location/Qualifiers
FT   CDS_pept        complement(309461..310480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0300"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: transcriptional regulator
FT                   protein; K02529 LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54611"
FT                   /db_xref="GOA:C6B0J2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS54611.1"
FT                   /translation="MTTSIRHIAKLAGTSVSSVSRVLNNSGYASPELRERVEAAIRTLN
FT                   YTPSKGARMLRGAPSRMIGLMLPSVDVPFFGILAHAIEQELFQHGYQTLICSTAENMDH
FT                   EVRYISMLLAQRVDGVIVASAFGSIEHFGVLRDAGIPIIAIDRELSGIADDAVMADHEE
FT                   GGRLMARHLIDLGHRAIAIVGAPAHSQPIQLRLQGITAEMAKDGIAPAIVAMAEEHSFA
FT                   ETYRLARELLASRPEVTAIIGTTDVSAIAAIHAIQDRGFSVPGDYSVVGFDDLPEAAYV
FT                   FPRLTTVAQPIRNVGQQAARLLEALIEEHQTGDESRQGAIVKVPVTLIERDSTGLVRN"
     gtgacgacca gcatccgaca tatcgctaaa cttgcaggaa cgtcagtctc ttcggtctcg        60
     cgcgtgctca acaacagcgg ttatgcctcg cctgagctca gggagcgggt cgaggcggcc       120
     atccgaacgc tgaactacac gccgagcaag ggtgcacgca tgctgcgcgg tgcaccaagc       180
     cggatgatcg gactgatgct gccgtcggtc gacgtgccct tcttcggcat cctggcccat       240
     gcgatcgaac aggaattgtt ccagcacggc tatcagacgc tgatctgcag cacggcggaa       300
     aatatggacc atgaggtgcg ctatatctcc atgctgctcg ctcagcgcgt cgatggcgtc       360
     atcgtggcaa gcgcctttgg cagcatcgag catttcggcg tgctgcggga cgctggcatt       420
     ccgatcatcg ccattgaccg cgagctgagc ggcatcgctg acgacgctgt catggccgat       480
     cacgaggaag gcggacggct gatggcgcgc catctgatcg acctcggcca ccgggcaatc       540
     gccattgtcg gcgcgccggc ccacagccag ccgatccagc ttcgccttca gggcatcacg       600
     gcagaaatgg cgaaagatgg catcgcgccc gccatcgtgg cgatggcgga agagcacagc       660
     tttgcagaga cctaccggct ggcgcgggaa ttgctggcgt ctcgacccga ggtcaccgcg       720
     atcatcggca cgaccgacgt ttcggcgatt gccgcaatcc atgccatcca ggatcgcgga       780
     ttttccgttc cgggcgacta ttcggtcgtg ggcttcgacg atctgccgga ggccgcctac       840
     gtctttccac ggctgacaac ggtcgcacag ccgatccgca atgtcggaca gcaggcagca       900
     cggctgctgg aagcgctgat cgaggagcac caaacaggag acgaatctcg gcaaggcgcg       960
     atcgtaaaag tgccggtcac cctgatcgag cgcgattcca ccggtctcgt ccgcaactga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page