(data stored in ACNUC7421 zone)

EMBL: CP001622.PE3

CP001622.PE3         Location/Qualifiers
FT   CDS_pept        complement(2893..4095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0003"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000399 oxygen-independent
FT                   coprophorphyrinogen III oxidase protein; TIGRFAM:
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM domain protein; HemN domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54315"
FT                   /db_xref="GOA:C6AY91"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY91"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ACS54315.1"
FT                   /translation="MDNFDTPSTSRDAALLPDTGEPGFGVYVHWPFCAAKCPYCDFNSH
FT                   VRHQPVDQERFTSAFLTEMAAVRAMSGPKTVTSIFLGGGTPSLMKPEAVSAILDGIARH
FT                   WHVPDGIEITMEANPSSVEAERFRGYRAAGVNRVSLGVQALNDRDLKFLGRLHDVADAL
FT                   KAIRLARDIFPRMSFDLIYARPDQTVEEWEKELKEAISYAVDHLSLYQLTIEEGTPFYG
FT                   LHKAGKLIVPDGEQSAVLYEATQEITAREGMPAYEVSNHARPGAESRHNLTYWRYGDYA
FT                   GIGPGAHGRLTRGPEKLATATERKPETWLDMVERDGHGILDEERLGFEEQSDELLLMGL
FT                   RLREGVDLARWQQLSGRDLDPKREEFLLEHKFIERIGNSRLRCTPSGMLILDSVVADLA
FT                   C"
     gtggacaatt tcgacacgcc aagcacctcg cgcgacgcgg ctctgctgcc cgataccggc        60
     gagccgggct tcggcgtcta tgtgcactgg cccttctgcg cggcgaagtg tccctattgc       120
     gacttcaaca gccatgtgcg ccaccagccg gtggatcagg agcgctttac atcagccttc       180
     ctgacggaga tggcggcggt ccgggcgatg agtgggccga agacggtgac gagcatcttc       240
     ctcggcggcg gcacgccctc gctgatgaag ccggaagcgg tttccgccat tctcgacggc       300
     attgcgcggc actggcatgt gccagatggc atcgagatca ccatggaggc caatccttcg       360
     agcgtcgagg ccgaacgctt ccgcggctac cgggcagccg gcgtcaatcg cgtctcgctc       420
     ggcgtgcagg cgctgaacga ccgggatctg aaattcctcg gccggctgca tgatgtcgcc       480
     gacgcgctga aggcgataag gctggcgcgc gatatctttc cgcgcatgtc cttcgacctg       540
     atctatgccc ggcccgacca gaccgtcgag gaatgggaaa aggaattgaa ggaggcgatc       600
     tcctatgcgg tcgaccatct ttcgctttat cagctgacca tcgaggaagg cacgcccttc       660
     tacggcctgc acaaggccgg caagctgatc gtgccggatg gcgagcaatc ggcagtgctc       720
     tacgaggcga cgcaagagat caccgcgcgc gagggcatgc cggcctatga ggtttccaat       780
     catgcccggc cgggggctga aagccggcat aacctgacct actggcgtta tggtgattat       840
     gccggcatcg gcccgggcgc ccatggccgg ctgacgcgtg gccccgagaa gctcgcgacg       900
     gcgaccgagc gcaagccgga aacctggctc gacatggtcg agcgtgacgg ccacggcatt       960
     ctcgacgagg agcggctcgg cttcgaggaa cagtccgacg agctgctgct gatggggctg      1020
     cggctcaggg aaggcgtcga tcttgcccgc tggcagcaac tttccggccg cgatctcgac      1080
     ccgaaacgcg aggaattcct gctcgaacac aaattcatcg agcggatcgg caattcacgg      1140
     ctgcgctgca cgccatccgg catgctgatc ctcgattccg tcgtcgccga tctcgcttgc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page