(data stored in ACNUC7421 zone)

EMBL: CP001622.PE30

CP001622.PE30        Location/Qualifiers
FT   CDS_pept        complement(28490..29911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0031"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: rec:RHECIAT_CH0000416 putative
FT                   2-methylthioadenine synthetase (MiaB-like) protein;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: Protein of unknown
FT                   function UPF0004; Radical SAM domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54342"
FT                   /db_xref="GOA:C6AYB8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB8"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ACS54342.1"
FT                   /translation="MTQDSALLQAPEAIPSDSLHDGSNSRKVFIKTYGCQMNVYDSMRM
FT                   SDALARDGYEPTDDMEEADLVLLNTCHIREKAAEKVYSALGRLRDMKKKKAADGREMMI
FT                   GVAGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRLAKQGQRVVDTEYAIEDKFEH
FT                   LPIAESRRIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEVSRPVSQIVEEAEKLADSG
FT                   VREITLLGQNVNAWHGAGPQGEAWSLGDLLYRLAEIPGLARLRYTTSHPRDMDDRLINA
FT                   HRDLSALMPYLHLPVQSGSDRILKAMNRRHTAAEYLTLIERIRTVRPDIALSGDFITGF
FT                   PGETDEDFKDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQVPEEIKAERLERLQMLL
FT                   LKQQQEFAESCIGKEIDLLLEKPGRMPEQLIGRSPWLQSVNVDAKASQIGDIIKVRITG
FT                   TGTNSLFAERAEAAV"
     atgacacagg atagcgccct tctccaggcc cccgaggcaa ttcccagcga cagcctccac        60
     gacggcagca acagccgcaa ggtcttcatc aagacctatg gctgtcagat gaacgtctac       120
     gattccatgc gcatgagcga tgcgctcgcc cgcgacggct acgagccgac ggacgatatg       180
     gaagaggcgg acctcgttct gctcaacacc tgccatatcc gcgagaaggc ggccgagaag       240
     gtctattcgg cgctcggacg gctccgcgat atgaaaaaga agaaggcggc ggacggacgg       300
     gagatgatga tcggcgttgc cggctgcgtc gcccaggccg aaggcgagga gatcctgcgc       360
     cgcgcacccg ccgtcgacgt cgtcatcggc ccgcagacct accaccgcct gccggaagcg       420
     ctacgcctgg ccaaacaggg ccagcgcgtc gtcgataccg aatatgcgat cgaggacaag       480
     ttcgagcatc tgccgatcgc cgagagccga aggatccgcg cccgcggcgt caccgccttc       540
     ctgacggtgc aggagggctg cgacaaattc tgcaccttct gtgtcgtgcc ctatacacgc       600
     ggctcggaag tgtcgcggcc ggtttcgcag atcgtcgagg aggccgaaaa gctcgccgac       660
     agcggggtgc gcgagatcac cctgctcggg cagaacgtca acgcctggca cggcgccggg       720
     ccgcaaggtg aggcatggag cctcggcgac ctgctctacc ggctggccga gatccccggc       780
     cttgcgcggc tgcgttatac cacaagccat ccgcgcgaca tggacgaccg gctgatcaat       840
     gcccatcgcg acctgagcgc actgatgccc tatctgcacc tgccggtgca atcgggctcg       900
     gaccgcatcc tgaaagcgat gaaccggcgc catacggccg ccgaatatct cacgctgatc       960
     gagcgcatcc gcacggtgcg gcccgacatc gcgctgtcgg gcgatttcat caccggcttt      1020
     ccgggggaga cagatgagga ttttaaggat acattgagac ttgtggagga ggtccgttat      1080
     gcacaggcct tctcgttcaa atactcgacg cggccgggca cgcccggcgc ggagctgaag      1140
     gaccaggtgc cggaagagat caaggcagaa cggctggaac gcctgcaaat gcttctcctg      1200
     aagcagcagc aggaatttgc cgaatcctgc atcggcaaag agatcgacct gttgctcgaa      1260
     aagcccggtc gcatgccgga acaactaatc ggacgttctc cctggcttca atccgtgaat      1320
     gttgatgcaa aagcatcgca aatcggtgac attatcaaag tgcgaatcac aggaaccgga      1380
     acaaacagcc tgtttgcgga acgcgcagag gctgcggttt aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page