(data stored in ACNUC7421 zone)

EMBL: CP001622.PE300

CP001622.PE300       Location/Qualifiers
FT   CDS_pept        310730..311380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ots:OTBS_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54612"
FT                   /db_xref="GOA:C6B0J3"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J3"
FT                   /inference="similar to AA sequence:KEGG:OTBS_0057"
FT                   /protein_id="ACS54612.1"
FT                   /translation="MNDTVLLFHGIARTKKSMAKLAGFLSGHGYRVVNVGYPSTRFSIS
FT                   DLIDIIRPEIDDAVKKAGDGRVHFVGYSMGGLVIRAFLRRYRPAKLGRVVMVGTPNNGS
FT                   QIADFLKSWPLYRKIYGPAGQQLITDQTAMTELFGTVDYELGIIAGNRTIDPVSSLIIG
FT                   LRVPNDGKVSVESTRLGGAAAHIVIPANHTFLPVNKTMWSQALSFLKDGRFTS"
     atgaacgaca cagttcttct ttttcacggc attgcccgga cgaagaaaag catggcgaag        60
     ctcgccggct tcctgtccgg ccacggttat cgggttgtga atgtcggtta cccctccacc       120
     aggttttcga tcagcgacct catcgacatc atccgaccgg agatcgacga cgccgtgaag       180
     aaagcaggcg atggccgggt ccatttcgtc ggttattcga tgggtgggct ggtcatccgc       240
     gcttttctca ggcgctatcg cccagccaag ctggggagag tggtcatggt cggaacgccg       300
     aacaacggca gtcagattgc cgatttcctc aagagctggc cactatacag gaagatctat       360
     ggaccggcag gacagcagct gattaccgat caaaccgcca tgaccgagct gttcggcacg       420
     gtcgattacg aacttggcat catcgccggg aaccggacca ttgatccggt ctcttcgctt       480
     atcattggcc tcagggttcc gaatgatggg aaggtttcgg tggagagcac gcgccttggc       540
     ggcgcggcag cacatatcgt cattccggca aaccacactt tcttgcccgt caacaagacg       600
     atgtggagcc aagccctgtc gtttctgaaa gatgggcggt ttacaagctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page