(data stored in ACNUC7421 zone)

EMBL: CP001622.PE301

CP001622.PE301       Location/Qualifiers
FT   CDS_pept        311455..312600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0302"
FT                   /product="polysaccharidase protein"
FT                   /note="KEGG: ret:RHE_CH00615 polysaccharidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54613"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00615"
FT                   /protein_id="ACS54613.1"
FT                   /translation="MTAILRKKVHGASTRGQVIDGAPDVGVAYQVFSDTVIEDVIVKNS
FT                   PRGFKFHNGKNLTVRRCETENVNGDGIYLTKTTHVLLENNRIGAAPGEGADCCQFAYQN
FT                   SDDNISSDIVIRGNLFLQSPASASNKGALVCDKTRQYLVEYNFIGGKNFSFSSIGDDAV
FT                   VRSNIMRDGRMNDYSFGYGVGDKADHAGHHIYDNWIENTNRGVSLSGFSDQELAFRKDI
FT                   DIHDNVISQCDIAFFANRRWSGSFRRNIFLRCEQDIVLKGNGKATAGDIDGNYRNDGSF
FT                   LNVTPPPLRLKPDGNASVASGEWTSEPDEIRIQWRNKGIDIPGANRPSFTAEPGMELSC
FT                   VLLARKDQNWMLAIAETAYDDFTPRAWQEHKLPWQKRYLSI"
     atgaccgcca tcctgcgaaa gaaagttcac ggcgcgtcta cacgcggaca ggtcatcgac        60
     ggtgcgcccg atgtcggcgt cgcctatcag gtgttttccg atacggtgat cgaagacgtt       120
     atcgtcaaga attcccctcg cggcttcaaa tttcacaatg gcaagaatct caccgtcagg       180
     cgctgtgaaa cggagaatgt gaacggcgac ggcatctacc tgacgaagac gacgcacgtg       240
     ttgctggaga ataatcgcat cggcgcggcc ccgggcgagg gagcagactg ctgccaattc       300
     gcctatcaaa acagcgacga caatatcagc tccgatatcg tgatccgcgg caacctcttc       360
     ctgcagtcgc cggcgagcgc atcgaacaag ggcgcgctgg tctgcgacaa aacgcgacaa       420
     tacctggtcg agtacaattt catcggcggc aagaatttct ccttttcgtc gatcggcgat       480
     gacgccgtgg tgcgcagcaa catcatgcgc gatggcagga tgaatgatta ttccttcggc       540
     tacggcgttg gcgacaaggc cgatcacgcc ggccatcaca tttatgacaa ctggatcgag       600
     aacaccaatc gtggcgtcag cctgagcggt ttttcggatc aggaactggc atttcgcaaa       660
     gacatcgata tccacgacaa cgtcattagc caatgcgaca tcgcgttctt cgccaaccgt       720
     cggtggtccg gcagctttcg gcgcaacata ttcctgcggt gcgagcagga catcgttctc       780
     aagggaaacg gcaaagcgac tgcgggtgat atcgatggca actatcgcaa cgatggcagc       840
     ttcctgaacg tcaccccgcc gccgcttcgc ttgaagcccg atggcaacgc gtccgttgcc       900
     tccggcgaat ggacatccga gcccgacgaa atccgcatcc agtggcgcaa caaggggatc       960
     gatatcccag gcgccaatcg gccctccttc accgcggagc ctggcatgga attgtcatgc      1020
     gtcttgctgg ctcgcaaaga ccagaactgg atgctggcga tcgccgagac tgcctatgac      1080
     gacttcacgc cgcgcgcatg gcaggaacac aagctgcctt ggcagaagcg ctatctctcg      1140
     atttaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page