(data stored in ACNUC7421 zone)

EMBL: CP001622.PE302

CP001622.PE302       Location/Qualifiers
FT   CDS_pept        complement(312632..313738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0303"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: cak:Caul_4545
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54614"
FT                   /db_xref="GOA:C6B0J5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J5"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACS54614.1"
FT                   /translation="MHQAKKMTSNNRRLVGLDGIRGLAAICVAVHHTEGFVGFDAAPAA
FT                   YLAVDLFFCLSGFVIGHAYERKLIQESSLSANDFAIKRLIRLYPLYLLGLLLGVLAYAG
FT                   MSLSRNQQIDPMLFATSLIASMFFLPAIGGTSLKAPNLFPFNGPSWSLFLEIVINLAYG
FT                   YAARMLSSGVLALILLASWVWLAAQTLAHGSADLIPLDGALLSGFPRVLFSFSLGILMY
FT                   RYRQRLSPSGIGKAAAVTTIVVATALLVFQAPAAWVGIKDLIVITALFPIAVLVLYTAN
FT                   FDGVLRQPLLIAGEASYALYAIHVPLLGLLLGAWKAAGLGQPPAWAIFAIVLPLIVLLA
FT                   IVVTRLYDEPVRKALSAGKAMRLRWRRS"
     atgcatcagg ctaaaaagat gacttcaaat aatcgtagac tggttggcct cgatgggatt        60
     cgtggcttgg cggccatttg tgtggcagtg catcacaccg aaggtttcgt cggatttgat       120
     gcagcacctg ctgcctatct cgccgtcgac ctgttttttt gtctcagcgg cttcgtgatc       180
     ggccacgcct atgagaggaa actcattcaa gagtcttcac tctctgccaa tgattttgcc       240
     atcaagcgtc tcatccgctt ataccccctg tatctgctcg gtttgctgct cggcgtactc       300
     gcatatgccg gcatgtcgct cagcagaaat cagcaaatcg atccgatgct gtttgccacc       360
     tcgttgattg cctcgatgtt cttcctgccg gcgatcggtg gaacatcgct gaaggcgccg       420
     aacctgttcc ccttcaacgg tccgtcatgg tccctattcc tagagatcgt gatcaacctg       480
     gcctacggct atgcggcgag aatgctgtcc agcggcgtac tcgcactcat cctgcttgcg       540
     tcatgggttt ggctggcggc gcaaacgctg gcccatggaa gcgccgacct gatcccgctc       600
     gacggcgcct tgctctccgg atttccccgc gttctctttt ctttcagcct cggcatcttg       660
     atgtaccgct accgtcagcg gctttcccct tcaggcatcg gaaaagccgc cgcagtgaca       720
     acaatcgtcg tcgcgaccgc tcttctcgtc ttccaggcgc cggccgcctg ggttggcata       780
     aaggacctga ttgtcatcac tgctttattt cctatcgccg tgcttgtcct ttacacagcc       840
     aacttcgatg gcgtgttgcg gcagccgctt cttattgcgg gagaggcgtc ttacgcgctc       900
     tatgcaattc atgttccgct gctgggcttg ctgttgggag cctggaaagc cgctggcctg       960
     ggacaaccgc cggcctgggc gatctttgcc atcgttcttc cgctgatcgt cctattggcc      1020
     attgtcgtca cccgcctcta cgatgaaccg gttcgcaaag cgctcagcgc tggaaaggcc      1080
     atgagacttc gctggcgtcg atcctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page