(data stored in ACNUC7421 zone)

EMBL: CP001622.PE303

CP001622.PE303       Location/Qualifiers
FT   CDS_pept        complement(313725..315080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0304"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG:
FT                   rec:RHECIAT_CH0003464 putative exopolysaccharide production
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54615"
FT                   /db_xref="GOA:C6B0J6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J6"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACS54615.1"
FT                   /translation="MSTSFDSYQPIGLQRHRPRARAQYRIRRETLVRILLSAIFYISLW
FT                   RATGMWYGLPADFQEGVGKDPMPMRLLLMSLVPLIGLYCLLEPRRVVEMLRSASPLVGI
FT                   ICLCVFLSIAFSVSVTASLRALVAVALLTAGPLLYRARYGAVDTFESLAKFAIATAFIN
FT                   ILYTAAFPRFAVMRGSYAGMVKGAFYHKNMLGQFSATNFILLLPALPMWRLRYYDLLRW
FT                   AAMLLYLVLIVLAKSSTAIILLSIGIAVYYGMSWIQRFPGRIFRSFVVLLAFALLGFVV
FT                   SVALMGVAQAIAESFGKDLTLSGRTNVWEQLLPLIYERPFSGWGFALFRQPDIMEQYVR
FT                   LTWDAQSTHNTYIELALNMGIPATIIWTSFVVVRLVGKMTSSPLNQALAITKRKEVVII
FT                   LLILIGAFTEAGMMLAPFILWPHTVIALTSLGPEFLSRFRKPTQAGAQHASG"
     atgagcacct catttgacag ctaccaaccg attggcctgc aaagacatag acccagagct        60
     cgcgcgcaat atcgcattcg gcgtgaaacc ctcgttcgga tcctcctctc ggcaatattt       120
     tatatttccc tctggagagc gactggcatg tggtacgggc tgcccgccga cttccaggag       180
     ggtgtcggca aagatcccat gccaatgcga ctgttgctga tgtcgctcgt tccactcatc       240
     ggcctctact gcttgctgga gcccaggcga gtcgttgaaa tgctccgcag cgcctcgccg       300
     ctggtcggca taatctgctt atgcgtcttt ctgtcgattg ctttttccgt cagcgttaca       360
     gcctcgctcc gggctctcgt cgccgtcgca ttgctgactg ctggacccct tctttacaga       420
     gcccgttatg gagccgtcga cacatttgaa agcttggcga aatttgccat tgccacggct       480
     ttcatcaata ttctttacac ggcagccttt ccccggtttg cggtgatgag aggcagttat       540
     gccgggatgg tgaaaggggc gttctaccac aaaaatatgc tcggccagtt ttcggcaaca       600
     aacttcatcc tgctacttcc agccctgccg atgtggcgcc tgcgctatta tgatctcctg       660
     cgatgggcgg caatgctgct ctacctcgtg ctcatcgtgc tggcgaaatc atcgacggcg       720
     atcatcctgc tttcgatcgg aatagccgta tactacggaa tgagctggat tcagcgcttt       780
     ccaggccgca tcttcagatc cttcgtcgtt cttcttgcat tcgccctgct aggcttcgtc       840
     gtctccgtcg cgttgatggg tgtggcccag gcgattgccg agtcattcgg gaaagacctt       900
     acgctcagcg gacgtacgaa tgtctgggaa cagttgctgc cgctgatcta cgagcggccg       960
     ttttcaggct ggggattcgc cttgttccga cagcccgata tcatggagca atatgttcgc      1020
     cttacgtggg acgctcaatc gacacacaac acctatatcg aacttgcgct gaacatgggc      1080
     ataccagcca ccatcatctg gacctcgttc gtcgtggtgc ggctcgtggg gaaaatgacc      1140
     tcgtcacccc tcaatcaagc gctcgccatc accaagcgaa aggaggttgt cattatcctc      1200
     ctgatcttga tcggcgcgtt caccgaagcc ggaatgatgc tggccccctt catcttgtgg      1260
     ccccacaccg tgatcgcgct tacgagtctt ggcccggagt tcctgtcccg cttccgcaaa      1320
     ccgacccagg caggggcgca acatgcatca ggctaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page