(data stored in ACNUC7421 zone)

EMBL: CP001622.PE304

CP001622.PE304       Location/Qualifiers
FT   CDS_pept        complement(315124..315858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: si:ch211-139a5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54616"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54616.1"
FT                   /translation="MLRLFANLVIVLALNFLLIVGNAGPSFAQECPDPAKATNASAQQK
FT                   QASKRLNRALPSYRVKSARYNLALVGDSLVELWQPWIKDSFPTRPAMNLAVAGDTTQNA
FT                   LYRLDDLDLPDFHPTDVVVLIGTNNLGAKTAPCAVAAGVVAVVSKVRALWPGAHIYALS
FT                   IPPRGKRYAFYEDVRIPANQLVASSLAEMPGVTFVQMNDDMLRCGKPSDKDCSNYKPDH
FT                   LHFNEGAYKLITSFLAAAGLQL"
     atgttgcgac ttttcgccaa cctcgtcatc gtcctcgcat tgaatttcct tctcatcgtc        60
     ggcaatgctg ggccgtcctt cgcacaggaa tgccctgacc ctgcaaaagc gacgaatgcc       120
     tcggcccagc aaaagcaggc aagcaagcga cttaatcgcg ctcttcccag ctatcgcgtc       180
     aaatcggccc gatacaatct ggctcttgtc ggcgattcgc tcgtcgaact ctggcagccc       240
     tggatcaagg acagctttcc cacccgcccg gcgatgaacc tcgcggtcgc cggcgacacc       300
     acgcaaaatg cattgtaccg cctcgatgat ctagaccttc cggatttcca tccgacggat       360
     gtcgtcgtgc ttatcggcac gaataacctg ggtgcgaaaa cggcgccatg cgccgtggcg       420
     gcgggtgtcg tggctgttgt cagcaaggtt cgcgctcttt ggccaggcgc ccatatttat       480
     gcgttgtcca taccgcctcg gggcaagcgc tacgccttct acgaggatgt ccgaattccg       540
     gccaaccaac ttgtcgcatc gtcattggct gaaatgcctg gtgtcacctt cgttcaaatg       600
     aacgatgata tgttgcggtg cggcaaacca agcgataagg attgttccaa ctacaagcct       660
     gaccatcttc atttcaatga aggggcatac aagctgatca cgagcttcct cgccgcagcg       720
     ggtctgcagc tttga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page