(data stored in ACNUC7421 zone)

EMBL: CP001622.PE305

CP001622.PE305       Location/Qualifiers
FT   CDS_pept        316093..316899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0306"
FT                   /product="Ku protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000691 putative DNA helicase
FT                   protein; TIGRFAM: Ku protein; PFAM: Ku domain protein;
FT                   SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54617"
FT                   /db_xref="GOA:C6B0J8"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J8"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACS54617.1"
FT                   /translation="MARQTFWKGYLKLSLVTAAVSLTPATTESNKVRFHVLNRQTKNRV
FT                   ESRYVDSVTHKPVAERDQVKGYPRGEDDYVLLEDEEIEEVGLESTRTIEIDNFVPRGSI
FT                   DWIWYDKPHFLAPEDKVGVEAFCVIREAMKANDVVGIARLVLYRRERAVLLEPLGKGIV
FT                   LWTLRYGDEVRDPVAELDNKTEIDSKLLALMTQLVKEETKNWSPAMVQDPIQKRLKSMI
FT                   RGKQKSLKKAAPAQKPAPVKSTGNVINIMDALKKSLAAEGGQKPRQ"
     atggcacgtc agacattctg gaaaggttat ctcaagctct cgctcgtcac cgccgccgtc        60
     tcgctgacgc cggcgacgac cgaaagcaac aaggtccgtt tccacgtcct caatcgccag       120
     acgaagaacc gcgtcgaaag ccgctatgtc gacagcgtca cccacaaacc ggtggccgag       180
     agggaccagg tgaagggtta tccgcgcggc gaggacgact atgttcttct cgaagacgag       240
     gagatcgagg aagtcgggct cgaaagcacc cgcaccatcg agatcgacaa tttcgtgccg       300
     cgcggctcga tcgattggat ctggtacgac aaaccgcatt ttctggcgcc cgaggacaag       360
     gtcggagtgg aagccttctg cgtcatccgc gaggcgatga aggcgaatga cgtcgtcggc       420
     atcgcccgcc ttgtcctcta tcgccgcgag cgtgcggtgc tgctggaacc gctgggcaaa       480
     ggcatcgttc tctggaccct gcgctatggc gacgaagtgc gggaccccgt ggccgaactc       540
     gacaacaaaa ctgaaatcga cagcaagctg cttgcgctga tgacgcaact ggtgaaggaa       600
     gagacgaaga attggagccc ggccatggtg caggatccga tccagaaacg cctgaagtcg       660
     atgatccgcg gcaagcagaa gagcctgaag aaggcggcgc ctgcgcaaaa acctgcaccg       720
     gtgaaatcga ccggcaacgt catcaatatc atggatgcgc tgaagaagag cctggcggcc       780
     gaaggcggcc agaagccgcg ccaatga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page