(data stored in ACNUC7421 zone)

EMBL: CP001622.PE306

CP001622.PE306       Location/Qualifiers
FT   CDS_pept        complement(317078..317932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0307"
FT                   /product="Ku protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000693 putative DNA helicase
FT                   protein; TIGRFAM: Ku protein; PFAM: Ku domain protein;
FT                   SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54618"
FT                   /db_xref="GOA:C6B0J9"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J9"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACS54618.1"
FT                   /translation="MAARASWKGHLKVGDLACAVGLYTAVSSSDRVSFNIINRRTGHRV
FT                   ERQFVDSETGKPVERGDQVKGYQMENGDYIVIEGDEIAEIMPESDKVLNIKAFIAYDDI
FT                   DKLYFDRPYYLAPVDEHDEEALSLIARGMRDGKVAALAEAVLFRRNRTLLIRPHDDYIV
FT                   ATMLNFDYEVRSAETVFEDIPDIKFDKEMIALAGHIIGTKQGSFEPSTYEDRYEAALVE
FT                   LVKAKIEGRAPPKKKPAPERKVVDLMEALRQSAKMSGNAPAKKALAKKKAPARSDSRSK
FT                   KAS"
     atggccgctc gggcaagctg gaagggtcat ctgaaggtgg gcgaccttgc ctgcgccgtc        60
     gggctctaca ccgccgtttc ctcctccgac cgcgtctcct tcaacatcat caaccgcagg       120
     accggccacc gggtggaacg gcaattcgtc gacagcgaga ccggaaaacc ggtcgagcgg       180
     ggcgaccagg tcaagggcta ccagatggag aatggcgatt acatcgtcat cgagggcgac       240
     gagatcgccg aaatcatgcc ggaaagcgac aaggtcctca atatcaaggc tttcatcgcc       300
     tatgacgata tcgacaagct gtatttcgac cgcccttatt atctcgcgcc cgtcgacgaa       360
     catgacgaag aggcgctgtc gctgatcgcc aggggcatgc gtgacggcaa ggtcgcggcg       420
     ctggccgaag ccgtgctttt ccggcgcaac cggacactgc tgatccgtcc gcatgacgac       480
     tacatcgtcg cgacgatgct gaatttcgac tacgaggtgc gctcggccga gacggttttc       540
     gaggacattc ccgacatcaa gttcgacaag gaaatgatcg cgcttgcggg ccatatcatt       600
     ggcaccaaac aaggcagctt cgaaccgagc acatacgaag atcgctacga agccgccctc       660
     gtcgagttgg tgaaggcgaa gatcgagggc cgggcgccac cgaagaagaa accggccccg       720
     gaacgcaagg tcgtcgacct gatggaagcg ctgcggcaaa gcgccaagat gagcggcaac       780
     gctccagcaa agaaggccct ggcgaagaag aaggcaccgg cgcgcagcga cagccgcagc       840
     aagaaggcaa gctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page