(data stored in ACNUC7421 zone)

EMBL: CP001622.PE307

CP001622.PE307       Location/Qualifiers
FT   CDS_pept        complement(317950..318183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54619"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000694"
FT                   /protein_id="ACS54619.1"
FT                   /translation="MADITYQVVPHDNGWAYKLGDTLSETYATADEAIIHAKDAASRQK
FT                   IGDGDALLAYPAPDGRGWAFQELETDKSGSRL"
     atggccgata tcacctatca ggtcgtgccg catgacaatg gctgggccta caagctaggc        60
     gacacacttt cggaaaccta tgcgacagcg gatgaagcga tcatccatgc caaggacgcc       120
     gcatcgcgcc agaagatcgg cgatggcgat gcgttgctcg cctatcccgc gcccgacggc       180
     cgtggctggg catttcagga actcgaaacc gacaagagcg gcagccggct ctga             234
//

If you have problems or comments...

PBIL Back to PBIL home page