(data stored in ACNUC7421 zone)

EMBL: CP001622.PE309

CP001622.PE309       Location/Qualifiers
FT   CDS_pept        318636..319196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0310"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG:
FT                   rec:RHECIAT_CH0000696 putative stress-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54621"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K2"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACS54621.1"
FT                   /translation="MADLKARPRPTGATAVLGRTGFPHVTSATKGEIDIVTAPSQPGFN
FT                   PLDLLYSSLSACLVLSARIAASQMGILDKINEITAEVTGEKATEGLSRVAKFNIAFSIK
FT                   GDIDEETRQKIAHAAEDEICTVSNTIRGNPEFSTTISGVRLNLHNNYRQSRAEDCVTNA
FT                   RLLCSGIESNDPGHHAAQASPDV"
     atggccgatc tcaaagctcg tccccgcccg accggcgcca ccgccgttct cggccgtacc        60
     ggtttcccgc acgtcacctc cgccaccaag ggcgaaatag atatcgtcac cgcgccgtcg       120
     cagccgggtt tcaatccgct cgatttgctc tattcctcgc tctcggcctg cctggtgctt       180
     agcgcccgca tcgccgccag ccagatgggc attctcgaca agatcaacga gatcactgcc       240
     gaggtcaccg gcgagaaagc gacggaaggc ctttcgcgcg tcgccaagtt caacatcgcc       300
     ttttcgatca agggcgatat cgacgaggaa acccggcaga aaatcgccca tgccgccgaa       360
     gacgagatct gcaccgtgag caacaccatc cgcggcaatc ccgagttctc gacgacgata       420
     tcgggggtaa ggctaaatct acataataat tatagacaat cgagagcgga ggattgcgtg       480
     accaatgccc ggcttctatg ctcgggcatc gaaagcaatg atcccggcca ccatgcagcc       540
     caagcctctc ccgacgtctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page