(data stored in ACNUC7421 zone)

EMBL: CP001622.PE31

CP001622.PE31        Location/Qualifiers
FT   CDS_pept        complement(30232..31029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0032"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000417 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase (phospholipid/glycerol acyltransferase)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54343"
FT                   /db_xref="GOA:C6AYB9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB9"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACS54343.1"
FT                   /translation="MIAWLRIAFAAVVILAVSIVLMPLQVLALRFDWRLRRRLPGTWHR
FT                   IVCYCLGIRVRVTGKLEDRRPLMLCSNHSSWLDIMVMSAVADVVFIAKIEVRDWPIFGT
FT                   LAKLQKSVFVVREERRKTGHQATEIAGRMADGEIVVLFPEGTTSDGNRLLEVKSSLFGA
FT                   AAMAVPTSPTGTVVVQPVAVAYTRVHGIAMGRYHRRLAAWPGDLDLLPHLIDIVRCGAI
FT                   DAEVSFGEAVDYRAETSRKEVSATIALRIRNLLNSRLRGREIS"
     ttgatcgcct ggctgcgcat cgccttcgcc gcggtcgtta tcctcgccgt cagcatcgtg        60
     ctcatgccgc tgcaggtact ggcgctgcgg ttcgactggc ggctgcggcg caggcttccc       120
     ggcacctggc accggatcgt ctgctattgc ctcggcatcc gcgtccgcgt cacgggcaag       180
     ctggaagatc gccggccgct gatgctctgc tccaaccatt cctcctggct ggatatcatg       240
     gtgatgtcgg ccgttgccga cgtcgtcttc atcgccaaga tcgaggtgcg tgactggccg       300
     atcttcggca cgctcgccaa gcttcagaag agcgtcttcg tcgtgcgcga ggagcggcgc       360
     aagaccggcc atcaggcaac cgagatcgcc gggcgcatgg ccgacggtga gatcgtcgtg       420
     ctcttccccg aaggcacgac ctcggacggc aaccggctgc tggaggtcaa gtcctcgctg       480
     tttggcgccg ccgcgatggc ggtgcccacg tcaccgacgg gaacggtcgt ggtgcagccg       540
     gtggcggttg cctataccag ggtgcatggc atcgccatgg ggcgttatca ccggcggctc       600
     gccgcctggc cgggggatct cgacctattg ccgcatctca tcgacatcgt acgctgcggc       660
     gccatcgacg ccgaagtttc cttcggcgag gcggtggact accgcgccga gaccagccgc       720
     aaggaggtga gcgcgacgat cgccttgcgc atccgcaacc tcctgaacag ccgcctgcgc       780
     gggcgggaaa tctcttag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page