(data stored in ACNUC7421 zone)

EMBL: CP001622.PE310

CP001622.PE310       Location/Qualifiers
FT   CDS_pept        319168..320604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0311"
FT                   /product="putative FAD-dependent oxidoreductase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000697 putative FAD-dependent
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54622"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000697"
FT                   /protein_id="ACS54622.1"
FT                   /translation="MQPKPLPTSEQPVVAIIGGGVSGAGVAYHLARANCGERLAIVVFE
FT                   PRAELGRGLAYDTADPAHRINVPAAKMSLQPDDLGEFLAWIEVRDAVAGDPEARQPDGS
FT                   LFPRRRLFGDYVASLLKPLLEDGSVRHCRAAVTAVERCAGRWSIRDDRGGVTKADIVAI
FT                   ATSHPPPTAPSRLGSRLAAHPRFVADTTKPNALDVIRPHDRVLVIGNGLTAADVIASLA
FT                   QRGHDGSVTAISRRGLRSRGHPLVPQELFGDFVSSAAHSAVSLLRGIRTAIGAAKAQGI
FT                   SWHGVIDQVRAQGYDLWQALPVAERRRLVRHLRPYWDVHRFRIAPQVEAVLDAAVTSGR
FT                   LDILAGSVADARIEGELILCSLQPRHQRQPLERRYDAVVVTTGPAHGGILDTQPWLAAL
FT                   AANGHLALDPTGLGLACTERSEAIGPSGKVDPSLLISGPLARGTFGELMGLPQVTEHAF
FT                   FVAGEIAEKLRTSATNRHPA"
     atgcagccca agcctctccc gacgtctgaa cagcccgtcg tcgccatcat cggcggcggt        60
     gtctccggcg ccggcgtcgc ctatcatctc gcgagagcca actgcggcga gcgccttgcc       120
     atcgtggttt tcgagccgcg tgccgaactc ggccgcggcc ttgcctacga cacggccgat       180
     ccggcccacc gcatcaatgt tccagccgcc aagatgagcc tgcagcccga tgacctgggc       240
     gaattcctgg cctggatcga agtccgcgat gcggtcgccg gcgaccctga ggccaggcag       300
     cccgatggct cgctcttccc ccggcgccgg ctgttcggcg attatgtcgc ctcgctgctg       360
     aagccgctgc tggaagacgg tagcgtgcgt cattgccgcg ctgcagtgac ggctgtcgaa       420
     cgctgtgccg gccgctggtc aatccgcgac gacagaggcg gcgtgacgaa ggccgatatc       480
     gtcgcgatcg ccaccagcca tccgccgccg acagccccaa gccggcttgg gagccggctt       540
     gctgcccatc cccgtttcgt cgccgatacc accaagccga acgcgctcga cgtgatccgc       600
     ccgcatgacc gggtgctggt cattggcaat ggcctgacgg ccgccgatgt catcgcctcg       660
     ctggcgcagc gcgggcatga cggttcggtg accgcgatct cgcgccgcgg gctgcggtct       720
     cgcggccatc cgctggtacc gcaggaactc ttcggcgatt tcgtctccag tgcagcccat       780
     tccgccgtgt cgctgctgag agggatccgt accgccatag gtgcggcgaa ggcgcagggc       840
     ataagctggc atggggtgat cgaccaggtg cgggcgcagg gatacgatct ctggcaggcg       900
     ctgccggtcg ccgaacgacg ccgtctcgtc cgccatctgc gtccctattg ggatgtgcat       960
     cgtttccgga tcgccccgca ggtcgaggcc gtgctcgacg cagctgttac ctcgggccgt      1020
     ctggatatcc tggccggctc ggtcgccgat gcgcgcatcg agggcgagct cattctttgc      1080
     tccctgcagc cgcgtcatca gcgccagccg ttggagcggc gctatgacgc cgtcgtcgtc      1140
     accaccggcc cggcgcatgg cggtattctc gacacccaac cctggctcgc agcactcgcg      1200
     gcgaacggtc acctggcgct cgacccgacc ggcctcggcc ttgcctgcac cgagcgctcg      1260
     gaggcgatcg gcccgtcagg aaaggtagat ccctcgctgc tgatctccgg cccgctggcg      1320
     cgcggtacat tcggcgagct gatgggactg ccgcaggtga ccgagcatgc ctttttcgtc      1380
     gccggcgaga ttgccgaaaa gctgcggacc agcgcgacga ataggcatcc tgcctga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page