(data stored in ACNUC7421 zone)

EMBL: CP001622.PE311

CP001622.PE311       Location/Qualifiers
FT   CDS_pept        320820..321725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0312"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rec:RHECIAT_CH0000698 putative
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54623"
FT                   /db_xref="GOA:C6B0K4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS54623.1"
FT                   /translation="MSQAAPTLSEASPSNRFALAALLLGGAAIGGSPIFVRLSEVGPMA
FT                   TAFWRVALALIPIVIVSLLKKERGPKPQSLSDYGMLILPGVILALDLAAWHLSLTMTSV
FT                   ANATLLANLAPVFVTLIAFVFFSARISRGFALGLVLALSGVVILKGGPAAIGNGDLRGD
FT                   GIAMIAAFFYACYILAIGRLRSRFDTLRIMLWSTTCAAACIFPIGLIYEGHMLPATVYG
FT                   WSIVFGLAFISHAGGQVAITYALAYLPPAFSSLTLLLQPVVAAILAWALLNEAIGTMQA
FT                   LGGAVVLAGIMIARTSRVQV"
     atgtcgcagg ccgcccccac cctttccgaa gcctcgcctt ccaatcgttt cgcccttgcg        60
     gcgctccttc tcggcggcgc ggcgatcggc ggctcgccga tcttcgtcag gctgtccgaa       120
     gtcggaccga tggcgacggc cttctggcgt gtggcgctgg cgttgatccc gatcgtcatc       180
     gtctcgctgc tgaagaagga aagggggccg aagccgcaaa gcctttccga ctacggcatg       240
     ctcattctcc caggcgtcat cttggcgctt gaccttgccg cctggcatct ttcgctcacc       300
     atgacgtcgg tcgccaatgc gactctgctt gccaacctcg cacctgtttt cgtcacgctg       360
     attgccttcg tctttttcag cgcgcggatc agccgcggct tcgcgctcgg gcttgtcctt       420
     gcgctctcag gcgtcgtcat tctgaagggc ggaccggcag ccatcggcaa tggcgacctt       480
     cgcggcgacg gcatcgcgat gatcgccgcc ttcttctatg cctgctacat ccttgcgatc       540
     ggcaggctgc gcagccgctt cgatacgctc cgcatcatgc tgtggagcac gacctgcgct       600
     gccgcctgca tctttccgat cggcctgatc tacgagggcc atatgctgcc cgcgaccgtc       660
     tatggctggt cgatcgtctt cggcctcgcc tttatcagcc atgccggcgg acaggtggcg       720
     atcacctatg cgctcgccta tctgccgccg gccttttcct cgctgacact gctgctgcag       780
     ccggtcgttg cggcaatcct ggcctgggcg ctgcttaacg aggcgatcgg aacgatgcag       840
     gcgctcggcg gcgccgtcgt gctggccggc atcatgattg cccggacatc ccgcgttcag       900
     gtgtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page