(data stored in ACNUC7421 zone)

EMBL: CP001622.PE312

CP001622.PE312       Location/Qualifiers
FT   CDS_pept        complement(321738..323294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0313"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; phospholipase/Carboxylesterase; KEGG:
FT                   rec:RHECIAT_CH0000699 putative glyoxalase/bleomycin
FT                   resistance protein/dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54624"
FT                   /db_xref="GOA:C6B0K5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54624.1"
FT                   /translation="MVSGIHHVTAVTRKVQANVDFYAGFLGMRLVKQTAGYEDATQLHL
FT                   FYGDGEGTPGSLLTFLAWEDGAPGRAGYGQISEISLSINPTSIGYWLTRAMSFGLSSEG
FT                   PADEFGEPVLRLKDPDNIILKLAGAKSLVSPAAWDGASIPVEHAIQRVRGATMLTEKPT
FT                   ESRSFLESHFGYRFQASRGTIDRLVSQSGDIIDVRDARGFWSGAPGTGTVDHVAFRAAD
FT                   EETLLVVRKALEATDASPTNMHDRKYFRSLYAREPGGTLVELATDKPGMTVDEEQAALG
FT                   GKLFAPPEAITNLHDLKVMLPQFSMPGQPRVNYRELPFVHRFYTPPDPDGSVFVLLHGS
FT                   GGNETTLMPLLNKAAPRATLLGVRGRATEEGFPRWYKRITPFSFDQNDIKTEAEAFAAF
FT                   IEGAVKSYGLDPQKVVYVGYSNGANLLNSLLYLHPHLVHKAVLLRSMPVLSDYPHADLK
FT                   GTDLLVISGKTDAYGKYASELEGRLKSSGATVDSDVIPGGHDLGDADIPIIQKWLLQEN
FT                   R"
     atggtatcag gtatacatca cgtcacggcc gtcacccgaa aggtgcaggc gaacgtggac        60
     ttttacgcgg gatttctcgg catgcggctc gtcaagcaga cagccggtta cgaggacgcg       120
     acgcagcttc atctcttcta tggcgatgga gaggggacgc cgggttcgct gctgaccttc       180
     ctcgcctggg aagatggtgc gcccggccgg gccggctatg gccagatcag cgaaatatcg       240
     ctgtcgatca accccaccag catcggctac tggctgacgc gtgccatgag cttcggcctc       300
     agctccgagg gaccggccga cgaattcggc gagcctgtcc tacggctgaa ggaccctgac       360
     aacatcatcc tcaagctcgc cggcgcaaag agcctggtat cgccggccgc ctgggacggc       420
     gcctcgatcc cggtcgagca tgccatccag cgggtgcgcg gcgcaaccat gctgacggag       480
     aagcccaccg aaagccgcag cttcctcgag agccatttcg gttaccgctt ccaggccagc       540
     cgcggcacga tcgacaggct ggtgtcgcaa tccggcgaca ttatcgacgt gcgcgatgcg       600
     cgcggcttct ggtccggcgc gccaggcacc gggacggtcg atcacgtcgc cttccgcgcc       660
     gccgacgagg agacgctgct tgtcgttcgc aaggctctgg aggcgactga cgcatcgccg       720
     accaacatgc atgaccgtaa atatttccgc tcgctctatg cccgcgagcc cggcggtacg       780
     ctggtggagc tcgccaccga caagcccggc atgaccgtgg acgaagagca ggccgccctc       840
     ggggggaagc tgttcgcacc gcccgaagcc atcaccaatc ttcacgacct gaaggtgatg       900
     ctgccgcaat tttcgatgcc cggccagccg cgtgtcaatt atcgcgagct gccattcgtc       960
     caccgtttct atacgccccc cgatcccgac ggcagcgtct tcgtgctgtt gcacggctcc      1020
     ggcggcaacg agacgacgct gatgccactg ttgaacaaag cggcgccgcg ggcgacgctg      1080
     ctcggcgtgc gcggccgggc gacggaggaa ggttttccgc gctggtacaa gcgcattacg      1140
     cccttctcct tcgaccagaa cgacatcaag accgaggcgg aggccttcgc ggcctttatc      1200
     gagggcgccg tcaaatccta cgggctcgat cctcagaagg tcgtctatgt cggttattcc      1260
     aatggcgcca accttttaaa ctcgctgctc tacctacacc cgcacctggt tcacaaggcc      1320
     gtgctgctgc gttccatgcc tgtgctcagc gattatccgc atgccgatct gaaaggcacg      1380
     gacctgctcg tcatcagcgg caagacggat gcctatggca aatatgcgag cgagttggaa      1440
     gggaggctga agagttcggg cgccaccgtc gattccgacg tcatccccgg cggccacgat      1500
     ctcggcgatg ccgacattcc gatcatccag aaatggctgc tgcaggaaaa ccgctga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page