(data stored in ACNUC7421 zone)

EMBL: CP001622.PE313

CP001622.PE313       Location/Qualifiers
FT   CDS_pept        complement(323379..324974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0314"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; KEGG: rec:RHECIAT_CH0000700 probable two-component
FT                   sensor histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54625"
FT                   /db_xref="GOA:C6B0K6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54625.1"
FT                   /translation="MAEHCSILIIDDNIDDLEVYRRILGRVSSTAYTVVEAETGEEGRA
FT                   LNGRKRPDCILLDYSLPGRDGLGVLADILEDDPAANVIMLTGQGSETVAVEVMKSGARD
FT                   YLTKDSLSPETLHRCIQNAIMHGMLEAKLEQKRQSLEIFTRAMAHDLKEPLRTIKSFTR
FT                   ILHGSAALPAEDRELLDYVLSAADHMEDLIVKVSGFTKLEASGGLELRPVSLSDVLDQV
FT                   EDNLRQQTESRGAVIIRGALPEVMGDATLLTQLLQNLVSNAIRYCEQKVPEISITGEAQ
FT                   GDTCRLTVRDNGPGIDPEHRELIFQPFKRLVGRGIEGTGLGLAICRRIAQMHGGSIWCE
FT                   AENGPGATFILEVPLAEARPVPSAASAVPHSTRPAEQQAEGSGRLAEVLLVEDSPADIQ
FT                   LLKIKLMRREKVNFNLHVATNGREAMRLLEERAGIADLPQIDLMLLDINMPIMDGFEVL
FT                   HALSADVRLKQIPVCILSTSSDESDMRRARNLGARAYMVKPPTLQQLEEALEDVENLEL
FT                   LQRGDSLALCAEQN"
     ttggcggaac actgctctat tctcatcatc gacgacaaca tcgacgatct cgaggtctat        60
     cgccgcatat tgggccgcgt ttccagcact gcctataccg tcgtggaggc ggagacgggc       120
     gaagagggcc gtgcgctgaa tggccggaaa cggccggact gcatcctgct cgactattcg       180
     ctgcctgggc gcgacgggct cggcgttctt gccgatatcc tggaggatga tcccgccgcc       240
     aacgtcatca tgctgaccgg ccagggcagt gagaccgtgg ccgtcgaggt gatgaagagc       300
     ggggcacgcg actatctgac aaaggattcg ctttcgcccg agacgctgca tcgttgcatt       360
     cagaacgcca tcatgcacgg catgctggag gcgaaactgg agcagaagcg gcagtcgctg       420
     gagattttca cccgcgccat ggcccatgat ctgaaggagc cgctccggac gatcaaatcc       480
     ttcacccgca tcctgcacgg ttctgcggcg ctgccggccg aagaccggga attgctcgat       540
     tacgtgctca gcgcggccga ccatatggaa gacctgatcg tcaaggtctc gggcttcacc       600
     aagctcgagg cctccggcgg actggagctc aggccggtct cgctctctga tgtgctcgac       660
     caggtggagg acaatctgcg ccagcagacc gaaagccgtg gagccgtcat catccgcggg       720
     gcgctgcccg aggtcatggg cgatgcgacg ctgctgaccc agctcctgca gaacctggtg       780
     tcgaacgcca tccgctattg cgagcagaag gttccggaga tcagcatcac aggcgaagcg       840
     cagggcgata cctgccgcct cacggtgcgt gacaacgggc ccggcatcga ccccgagcac       900
     cgcgaactga tcttccagcc gttcaagcgt ctcgtcggcc gtggcatcga aggcaccggg       960
     ctcggccttg ccatctgccg ccgcatcgcg cagatgcatg gcggctcgat ctggtgcgag      1020
     gcagaaaatg ggccgggcgc caccttcatt ctcgaagtgc cgctcgccga ggcgaggccc      1080
     gtgccatcag ccgcatcggc cgtgccgcac agcacaaggc cggcggagca gcaagccgaa      1140
     ggttcgggca ggcttgccga agtgctgctg gtggaagaca gcccggccga cattcaactt      1200
     ctgaagatca agctgatgcg gagggagaag gtgaacttca acctgcatgt cgccaccaac      1260
     gggcgcgagg cgatgcggct gctcgaagaa cgcgccggca ttgccgatct gccgcagatc      1320
     gacctcatgc tgctcgacat caacatgccg atcatggacg gcttcgaggt gctgcatgcg      1380
     ctttcagccg acgtgcgcct caagcaaatt cccgtctgca tcctcagcac atcaagcgac      1440
     gagagcgaca tgcggcgggc cagaaatctc ggtgcgcgcg cctatatggt caagccgccg      1500
     accctgcagc aactagaaga ggcactcgaa gatgtcgaga atttggagtt gttgcagcgc      1560
     ggcgattcgc ttgcgctttg tgcggaacaa aactaa                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page