(data stored in ACNUC7421 zone)

EMBL: CP001622.PE314

CP001622.PE314       Location/Qualifiers
FT   CDS_pept        complement(324979..325404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0315"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000701 probable
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54626"
FT                   /db_xref="GOA:C6B0K7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54626.1"
FT                   /translation="MQQRDTQPILIVEDSEDDFEATMRAFKRTNLRNSIRWAASGQEAL
FT                   DMLAEMVPKPGLILLDLNMPGLDGRKTLEAIKSNAGWRKIPVVILTTSDDERDIEGCYA
FT                   LGANTYVQKPVDLDGLFAAIQRLKEYWFEIAILPLED"
     atgcagcagc gtgatacgca accgatcctg atcgtcgagg acagcgaaga cgatttcgaa        60
     gcgacgatgc gcgccttcaa acgcaccaat ctgcgcaact cgatccgctg ggcggcctcc       120
     ggtcaggaag cgctcgacat gctcgccgag atggtgccga aaccggggct gatcctgctt       180
     gacctcaaca tgccgggtct tgacggccgc aagacgctgg aggcgatcaa gtcgaacgcc       240
     ggctggcgca agatcccggt ggtcatcctc acgacctccg acgacgaacg cgatatcgaa       300
     ggctgctacg cgctcggcgc caatacctat gtgcagaagc cggtggatct cgacgggctc       360
     tttgccgcga tccagcggct gaaggaatac tggttcgaaa tcgcgatcct gccactcgag       420
     gactga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page