(data stored in ACNUC7421 zone)

EMBL: CP001622.PE315

CP001622.PE315       Location/Qualifiers
FT   CDS_pept        complement(325391..327532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0316"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rec:RHECIAT_CH0000702 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; PAS domain containing
FT                   protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54627"
FT                   /db_xref="GOA:C6B0K8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS54627.1"
FT                   /translation="MQDQGNVDLQDQPRQHYRAFAIAVGCLMLLLGATALTGWLLQAEI
FT                   VISLVPGFPSMAFNTALCFVLSGAGLAASTLAARRFRIMAAITMGLAAAIAAARLVEIV
FT                   TIGRSFHNVDVLISRFLVSPDFLAEIGGGMGPNTALVFLIANLSLLLSLQVEKSRSQVV
FT                   QELTSYVVITLGMIALASYVTDAEQGYRWGPYAAMALHTAAGMVIFGSGLLARSWWMQP
FT                   ANRAQIPLWIPAAVCFTGLLVDLYTPLGVANGILYVPLVLTALWFGNRNAPLFFAFACT
FT                   VLLMLGFFAVKHNEAAFWQEIANRAITAATLWLIAILVFYFMRNNYNLETERVRFGALV
FT                   RGTPDAVVVIDERGTIRNFNPAAESMFGYSPQETIGKNIKMLMPEPYHSEHDGYLAHYR
FT                   QTGDERIIGTTRMVSGRRKNGIVFPIDVSISAVVTGHTKTFVGIVRDISERVRQEERMK
FT                   TTLSQLEAYTAELERSNHDLDEFAYIASHDLKEPLRGLHNHSRFLLEDYEDKLDADGVR
FT                   RLNRLVRLSQRMEKLVNELLYFSRLGRQQLAVKRTDIGLIVKDVVATMELLLEERHAKV
FT                   IIDGRLPEVVCDATRLTEVFRNLITNAIKYNDKPAPLVSIGYLDRFVGKDGTVARNVFF
FT                   VKDNGKGIPREFHEDIFRIFKRLEKSQDSDDGTGAGLTFVRKIIARHNGDIWLESEVGT
FT                   GTTFYFTLGKKREGQNAAA"
     gtgcaggatc agggcaacgt ggacctgcag gaccagccaa gacagcacta ccgagccttt        60
     gcgattgccg tcggctgcct gatgttgctt ctcggcgcga cggcgcttac cggctggctg       120
     ctgcaggccg agattgtcat ctcgctggtt cccggctttc cgtcgatggc tttcaacacc       180
     gcgctctgct ttgtgctttc cggcgcaggg ctggccgcct cgacgctggc cgcccgccgt       240
     tttcgaataa tggcagcgat cacgatgggg cttgcggcgg cgatcgccgc ggcccgcctc       300
     gtcgaaatcg tcacgatcgg gcggagtttt cacaatgtcg acgtgctgat ctcgcgcttt       360
     ctggtttcgc cggatttcct cgccgagatc ggcggcggca tggggccgaa cacggcattg       420
     gtcttcctga ttgccaatct ttcgctgctg ctctcgctcc aggtggagaa gtcgagaagc       480
     caggtggtgc aggaattgac gagctatgtc gttatcacgc tcggcatgat cgcgctggcc       540
     agctatgtca ccgatgccga acagggctac cgctggggcc cctatgcggc gatggcgctg       600
     cacacggcgg ccggcatggt aatcttcggc tcggggcttc tcgcccgctc ctggtggatg       660
     cagccggcaa accgggcaca gatcccgctc tggatcccgg ctgcggtctg cttcaccggt       720
     cttctcgtcg atctctatac gccgctgggt gtcgccaacg gcattctcta cgtaccgctg       780
     gtgctgacgg cgctctggtt cggcaaccgg aacgcgccgc ttttcttcgc ctttgcctgc       840
     accgtgctcc tgatgctcgg cttcttcgcc gtcaagcaca acgaggcggc gttctggcag       900
     gaaatcgcca accgtgccat cacggctgcc acgctttggc tgatcgcgat cctcgtcttc       960
     tatttcatgc gcaacaacta taacctcgaa accgagcgcg tccgcttcgg cgcgctggtg      1020
     cgcggcacgc ccgatgccgt cgtcgtcatc gacgagcgtg gaacgatcag gaatttcaat      1080
     ccggcggctg aaagcatgtt cggttactcc ccgcaggaga cgatcggcaa gaacatcaag      1140
     atgctgatgc ccgaacccta ccattccgag catgacggct atctcgccca ctaccggcag      1200
     actggcgacg agcgcatcat cggcacgacg cgcatggtct ccggacgacg caagaacggc      1260
     atcgtctttc cgatcgacgt ttccatcagc gccgtcgtca ccggccatac gaagaccttc      1320
     gtcggtatcg tgcgcgacat cagcgagcgc gtccggcagg aagaacggat gaaaacgacg      1380
     ctttcccagc ttgaggccta tacggccgaa ctcgagcgca gcaaccacga cctcgatgaa      1440
     ttcgcctata tcgcctcgca tgatctcaag gaaccgctgc gcggcctgca caaccactcc      1500
     cgcttcctgt tggaagatta tgaagacaag ctcgatgcgg acggcgtgcg ccggctgaac      1560
     cggctcgtgc gtctcagcca gcgcatggag aaactcgtca acgagcttct ttatttctcc      1620
     cggctcggac gccagcagct ggcggtcaaa cgcaccgata tcggcctgat cgtcaaggat      1680
     gtcgtcgcga cgatggagtt gctactcgag gaacgacacg ccaaggtgat catcgacggc      1740
     cggctgccgg aggtggtctg cgacgcgacg cggctgaccg aagtgttccg caatctcatt      1800
     accaacgcga tcaaatacaa tgacaagccg gcgccgctcg tctcgatcgg ctatcttgat      1860
     cggttcgtcg gcaaggacgg cacggttgcc cgcaacgtgt ttttcgttaa ggataacggc      1920
     aagggcattc cgcgggaatt ccacgaggat attttccgca ttttcaaacg gctggaaaag      1980
     tcgcaggatt ccgacgacgg gaccggagca ggcctcacct tcgttcgcaa gatcatcgcc      2040
     cggcacaatg gcgatatctg gctggaatcc gaggtcggca ccggcacgac attctacttc      2100
     actctgggaa aaaagcgcga ggggcagaat gcagcagcgt ga                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page