(data stored in ACNUC7421 zone)

EMBL: CP001622.PE316

CP001622.PE316       Location/Qualifiers
FT   CDS_pept        327726..328103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0317"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000703 putative
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54628"
FT                   /db_xref="GOA:C6B0K9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54628.1"
FT                   /translation="MTTLFYVDDSKDDLFYLDYMSRKQQIDIDLFCFSTAETALEALET
FT                   RAAEGKTSPDLLVADLYMPLDSGIGLITRLRLDDRFKAMRLAICSGSDAAEDRARSLDA
FT                   GADVYLEKPLDLAKIILNLEM"
     atgaccaccc tattttatgt cgacgacagc aaggatgacc tcttctatct cgactatatg        60
     agcagaaagc agcagataga catcgatcta ttctgtttct ccacagccga gaccgcgctt       120
     gaggcgctgg agacgcgcgc ggcagaaggc aagacctcgc ccgatcttct ggtcgccgat       180
     ctctacatgc cgctcgatag cggcattggc ctgatcacgc ggttgcgcct ggatgatcgt       240
     ttcaaggcga tgcgacttgc tatctgcagc ggatcggatg ctgccgagga ccgcgcccgc       300
     tcactcgatg ccggcgccga tgtctatctg gaaaagccac ttgaccttgc caagatcatt       360
     ctcaatcttg agatgtag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page