(data stored in ACNUC7421 zone)

EMBL: CP001622.PE317

CP001622.PE317       Location/Qualifiers
FT   CDS_pept        328584..329288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0318"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG:
FT                   ret:RHE_CH00628 LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54629"
FT                   /db_xref="GOA:C6B0L0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0L0"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54629.1"
FT                   /translation="MNNAPAIPFHAGPELSRAINRTDFFRLLKSAAQHYNFDNFALARI
FT                   SEASAPFGERDVVITNVAERRVGLFITTLKEALGTVRAKTAQFLATPVHGRSAQPEVYP
FT                   SDLVFNEFLSGVFLFIPLFTPEGRRYCLVLSGERQEPDQSEIADILLDAMRIFDKLYEE
FT                   ILTPEMSGRLTQRESEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVH
FT                   MVAIALRNGLVS"
     atgaacaatg ccccggcaat tccctttcat gccggaccgg agctgagccg ggcgatcaac        60
     cgcaccgatt ttttccgtct gctgaaatcg gcggcgcagc attacaactt cgacaatttt       120
     gcgctggccc gcatttccga ggcttcggcc cctttcggtg aacgtgatgt cgtcatcacc       180
     aatgtcgccg agcggcgtgt cggccttttc atcacgacgt tgaaggaagc gctgggcacc       240
     gtccgggcaa agaccgccca gttcctggca acgccggtcc atggcaggag cgcacagccg       300
     gaagtttatc cgtccgatct ggttttcaac gaattcctga gcggcgtctt tctcttcatc       360
     ccgctgttta cgccggaagg gcggcgatat tgcctcgtgc tcagcggcga gcgtcaggag       420
     ccggatcaga gtgagatcgc cgacatactt ctcgacgcca tgcgcatttt cgacaagctc       480
     tacgaggaaa tcctgacgcc ggaaatgtcc ggacggctga cccagcgcga atcggaaatc       540
     gtcaaatgga cgagcgaagg taagacgtcg gcggaaatcg ccatcattct cggtctctcc       600
     gaacatacgg tcaattcgca catcaccgcg gccgcgcgca aactcgacgc tgtcaaccgc       660
     gttcatatgg tggcgatcgc cttgaggaat ggtttggttt cgtga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page