(data stored in ACNUC7421 zone)

EMBL: CP001622.PE318

CP001622.PE318       Location/Qualifiers
FT   CDS_pept        329319..329756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0319"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000705 putative two-component
FT                   response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54630"
FT                   /db_xref="GOA:C6B1B1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000705"
FT                   /protein_id="ACS54630.1"
FT                   /translation="MITETGRRNAVKVLFVDDEFIEFRALKKKIADLSEPAVEVEYSPS
FT                   IGDALEKIRLARFDLILLDNRLLPNADFRETVPELRGIGYTGPIGVVSTDISGGYFQEF
FT                   PDYGVDFRIGKDEIDAQTLQHIIREYVTYDVPDFWKDDYSI"
     atgatcaccg aaacgggccg gaggaacgcc gtaaaggttc tctttgtcga cgacgaattt        60
     atcgaattcc gcgcgctcaa gaagaagatc gccgatctct ccgagccggc agtcgaggtt       120
     gaatattcgc catcgatcgg tgacgcgctg gaaaagatcc gcttggcgcg cttcgatctc       180
     atcctgctcg acaatcgcct tctgcccaat gccgatttcc gcgagacggt gccggagctg       240
     cgtggcatcg gctacaccgg cccgatcggc gtcgtctcga ccgatatatc gggcggctat       300
     ttccaggaat tcccggatta cggcgtcgat ttccgcatcg gcaaggacga aatcgatgcc       360
     cagacgctac agcacatcat ccgcgaatat gtgacctatg acgtcccgga tttctggaag       420
     gacgattata gtatctaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page