(data stored in ACNUC7421 zone)

EMBL: CP001622.PE319

CP001622.PE319       Location/Qualifiers
FT   CDS_pept        complement(329760..330476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0320"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: ret:RHE_CH00630 putative two-component
FT                   sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54631"
FT                   /db_xref="GOA:C6B1B2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54631.1"
FT                   /translation="MSSNPTRPPETTVAGDSEERIKRFLATASHDLQSPLRHIAMYAEL
FT                   LLDDLEETLDGEQLQSLRMIMEKAQTAQRLTKALMSLAAGTPQVTPEEVDLQALAENVW
FT                   GELTDETAVGAATLESDGLPSIRTDPALLGLVLRHLLTNALTYRGEAPPHVAIAAERER
FT                   TDWFIRISDNGTGIDPAYRERIFEPFWKLPKAGAVPGAGLGLTTAREFLAALGGDISLE
FT                   RSDESGSRFIIRLPIA"
     atgtcatcca acccgacaag accgccggaa accaccgttg ccggagacag cgaggagcgc        60
     atcaagcgtt ttctcgcgac tgcctcgcac gacctgcaat caccgctccg ccatatcgcc       120
     atgtatgccg agctgctgct cgacgatctc gaggagacgc tcgacggcga acagcttcag       180
     agcctccgga tgatcatgga aaaggcgcag acggcgcagc gcctcaccaa ggcattgatg       240
     agccttgccg ctggcacacc tcaggtgacg cctgaagagg tcgatctgca ggcgctcgcc       300
     gaaaatgtct ggggcgaact gaccgacgag acggcggtcg gcgcagcgac gcttgaaagc       360
     gacggcctgc cctcgatccg taccgaccct gccctcctcg gtctggtgct gcggcacctt       420
     ttgaccaatg ccctcaccta ccgcggggaa gcgccgccgc atgtggccat tgccgcggag       480
     cgcgagcgga cggactggtt catccggatt tccgacaatg ggacaggcat cgatccggct       540
     tatcgagagc ggatattcga gccgttctgg aaattgccga aggcgggagc ggtcccgggc       600
     gccggtctcg gattgaccac ggcgcgtgag tttctggcgg cgcttggcgg cgatatcagc       660
     ctcgaacgtt cggatgaaag cggcagtcgc ttcatcatcc gccttcccat cgcttga          717
//

If you have problems or comments...

PBIL Back to PBIL home page