(data stored in ACNUC7421 zone)

EMBL: CP001622.PE32

CP001622.PE32        Location/Qualifiers
FT   CDS_pept        complement(31057..31485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0033"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG:
FT                   rec:RHECIAT_CH0000418 ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54344"
FT                   /db_xref="GOA:C6AYC0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC0"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACS54344.1"
FT                   /translation="MTDVAKTLEELCTERGMRMTEQRRVIARILEDSEDHPDVEELYRR
FT                   SVKVDAKISISTVYRTVKLFEDAGIIARHDFRDGRSRYETVPEEHHDHLIDLKTGTVIE
FT                   FRSPEIEALQERIAREHGFRLVDHRLELYGVPLKKEDL"
     atgactgatg tagccaagac ccttgaggag ctttgcaccg aacgcggcat gcgcatgacc        60
     gagcagcgcc gcgtgatcgc gcgcatcctg gaagactcgg aagaccatcc cgacgtcgaa       120
     gaactctacc gccgctcggt gaaggtcgat gcgaagatct cgatctcgac cgtctatcgc       180
     accgtgaaac tgttcgagga tgccggcatc atcgcccgcc acgacttccg cgacggacgc       240
     tcgcgctatg aaacggtgcc ggaagaacat cacgaccatc ttatcgacct gaagaccggc       300
     acggtcatcg aattccgctc gccggagatc gaagcgctgc aggagcgcat cgcccgcgag       360
     cacggcttcc ggctggtcga ccaccgcctc gagctctacg gcgttccgct gaagaaagaa       420
     gatctctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page