(data stored in ACNUC7421 zone)

EMBL: CP001622.PE320

CP001622.PE320       Location/Qualifiers
FT   CDS_pept        complement(330635..333181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0321"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein SecF; protein-export
FT                   membrane protein, SecD/SecF family; PFAM: SecD/SecF/SecDF
FT                   export membrane protein; KEGG: rec:RHECIAT_CH0000707
FT                   protein-export translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54632"
FT                   /db_xref="GOA:C6B1B3"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B3"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ACS54632.1"
FT                   /translation="MRTSRWLVITYSVIILLGLLIALPNVLPQSVLQRVPAWLPHEQVS
FT                   LGLDLRGGSHLVLEVDEADLTKERLQSLLQDARRVLREKGIQPKAVVRSQNQIVVTLAD
FT                   AAQSDAAVTELKTLANPISTGLSAGQADLAVTANGATITVGFSPAGISANVDNAVQQSL
FT                   EVIRQRVDQVGVSEPTIQRIGANRVLVQLPGAQDPSRLRELLGSTAKMSFHMLSPNNAP
FT                   GPGVTMLKDDEGRSFPVLDRVEISGDRLSDARVSFDPNTHEPIVSFRFDSAGASRFAEI
FT                   TRQNVGNPFAIVLDDKVLSAPVIREPITGGSGQISGSFSADSATTLAAMLRAGALPAKL
FT                   TVIEERTVGADLGADAIKMGIYSGIVGFVLVAVFIFVLYGTWGFLANIALLIHTILTFS
FT                   ALTLVGATLTLPGIAGVVLGIGLAVDANVLINERIREETRKGKSAFAAIDTGFRRAYST
FT                   IIDGNMTALIAAAILFFFGSGPVRGFAVTMALGLIISMFTSVAFVRVAMIEITRRSKLK
FT                   VLNIRPLIPFSPYDKHIQFMKARFFGITVSALLSIASIVLFIHPGLNYGVDFRGGIQMA
FT                   VKTTGPADLGTFREGLNTLGLGEISLQSFGDKNSILVRAQRQEGGEEAQTAAVTKLKAE
FT                   VTKIDPTATIEGTDVIGPKVSGELAWAGILSVVIASFAMLIYIWVRFEWPFAVGAIVTL
FT                   VLDVTKAIGFFAITGLDFNLTAIAAILTLVGYSVNDKVVVYDRMRENMRLYKSMPLREI
FT                   IDKSINETLARSLYTNATAFLALVPMAIWGGSAVSSFAIPMVFGILVAGASSIFIAAPI
FT                   LLFLGDWRRRHAKASATDAAVEIIPPEQGRPRKSAS"
     atgcgtactt cacgatggct ggtgatcacc tattcggtga tcatcctact cggcctattg        60
     atcgccctgc cgaacgtcct gccgcaatcc gtcctccagc gcgtgccggc ctggctgccg       120
     catgagcagg tgtcgctcgg cctcgacctt cgcggcggtt cgcacctcgt tctggaagtc       180
     gacgaagccg acctgaccaa ggagcggctg caatcgctgc ttcaggacgc gcgccgtgtg       240
     ctgcgcgaaa agggcattca gccgaaggcc gtggtccgca gccagaacca gatcgtcgtg       300
     acgcttgccg atgccgcgca gagcgatgct gccgtcaccg aactcaagac gcttgccaac       360
     ccgatcagca ccggcctcag cgccggccag gccgatctgg ccgtcactgc gaacggcgcc       420
     accatcaccg tcggcttctc gccggccggc atctccgcca atgtcgacaa tgccgtccag       480
     cagagcctcg aagtcatccg ccagcgcgtc gaccaggtcg gcgtctccga gccgaccatc       540
     cagcgcatcg gcgccaaccg cgtgctcgtc cagcttccgg gcgcgcagga tccgtcacgc       600
     ctgcgcgaac ttctcggctc caccgccaaa atgtcgttcc acatgctgtc gccgaacaat       660
     gcgcccggac ccggcgtgac catgctgaag gacgacgaag gccggtcctt tccggtcctc       720
     gaccgcgtcg aaatctccgg cgaccgcctt tcggatgccc gcgtcagctt cgacccgaac       780
     acgcatgagc cgatcgtcag cttcagattc gacagcgccg gcgccagccg ctttgccgag       840
     atcacccgcc agaacgtcgg caatcccttc gccatcgtcc tcgacgacaa ggtgctgagc       900
     gcgcctgtta tccgcgagcc gattaccggc ggttccggtc agatctccgg cagtttctcg       960
     gccgatagcg ccacgacgct ggccgccatg ctgcgcgctg gcgccctgcc cgccaagctg      1020
     acggtcatcg aagagcgcac cgtcggtgcc gacctcggag ccgacgccat caagatgggc      1080
     atttattccg gcatcgtcgg ctttgtgctc gtcgccgtct tcatcttcgt actctatggc      1140
     acctggggct tcctggcgaa tatcgcgctg ttgatccaca cgatcctgac cttctcggcg      1200
     ctaacgctgg ttggtgcgac gctgacgctg ccgggcattg ccggtgtcgt tctcggcatc      1260
     ggccttgcgg tcgacgccaa cgttctcatc aacgagcgca tccgcgaaga aacgcgcaag      1320
     ggcaagagcg ccttcgccgc catcgatacc ggtttccgcc gtgcctattc gaccattatc      1380
     gacggcaaca tgacggccct gatcgctgcg gccatcctgt tctttttcgg ctccggaccg      1440
     gttcgcggct ttgccgtgac catggcgctc ggtctgatca tctcgatgtt cacatcggtc      1500
     gccttcgtgc gtgtggcgat gatcgagatc acccgccgca gcaagctcaa ggtgctgaac      1560
     atccggccgc tgatcccgtt cagcccctat gacaagcaca tccagttcat gaaggcgcgc      1620
     ttcttcggca tcaccgtttc agcgctgctt tcgatcgcct ccatcgtgct cttcattcat      1680
     ccgggcctca actacggcgt cgatttccgc ggcggcatcc agatggccgt caagaccacc      1740
     ggcccggccg acctcgggac gttccgtgaa ggcctgaaca cgcttggtct cggcgaaatc      1800
     tcgctgcagt ccttcggcga caagaacagc attctcgttc gcgctcaacg gcaggaaggc      1860
     ggcgaagagg cacagacggc agcggtgacc aagctgaagg cagaagtcac caagatcgat      1920
     ccaaccgcca ccatcgaagg caccgacgtc atcggcccga aggtcagcgg cgagcttgcc      1980
     tgggccggta tcctgtcggt ggtgatcgcg agcttcgcga tgctcatcta catctgggtg      2040
     cggttcgaat ggccgtttgc cgtcggcgcc atcgtcacgt tggtgctcga cgtcacaaag      2100
     gcgatcggct tcttcgcgat caccggtctc gacttcaatc tgacggccat cgccgccatt      2160
     ctgacgcttg taggttattc ggtgaacgac aaggtcgtcg tctatgaccg catgcgcgaa      2220
     aacatgcggc tctacaagtc gatgccgctg cgcgagatta tcgacaagtc gatcaacgag      2280
     accctggcgc gaagccttta caccaatgcg acggccttcc tcgcgctggt gccgatggcg      2340
     atctggggcg gtagtgcggt gtcgagcttc gcgatcccga tggtcttcgg cattctcgtg      2400
     gccggcgcct cttcgatctt catcgcggca ccgatcctgc tcttccttgg cgactggcgc      2460
     cgccgccatg ccaaggcatc ggcaaccgat gcggcagtcg agatcattcc gccggaacag      2520
     ggtcgtccgc gcaagtccgc gagctaa                                          2547
//

If you have problems or comments...

PBIL Back to PBIL home page