(data stored in ACNUC7421 zone)

EMBL: CP001622.PE321

CP001622.PE321       Location/Qualifiers
FT   CDS_pept        complement(333265..333645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54633"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000708"
FT                   /protein_id="ACS54633.1"
FT                   /translation="MELEQHRLTSRIAASVLVAVLAYLGLLFGGNLVISPAAAANTLSS
FT                   SGRDPQPPQLTARDTVRGLLATERKLVPKQTAHDGGSPALAAAPTLNFAGWNISAAFPA
FT                   FEASLHAAVSRTHQPRAPPVAA"
     atggagctgg aacagcaccg tctgacgagc cgtatcgccg cttccgtcct cgtcgccgtc        60
     cttgcctatc ttggcctgct tttcggcggc aatctggtga tctcgccggc ggcggccgcc       120
     aatacgcttt cctcttccgg tcgagatcct cagccgccgc agctgactgc gcgcgatacc       180
     gtgcgtgggc tgcttgccac ggagcgcaag cttgtgccga agcagacggc acatgacggc       240
     ggatcgcctg cccttgccgc cgctccgacc cttaacttcg ccggctggaa tatatcagcg       300
     gcttttccgg catttgaagc ttcgcttcac gccgcagtct ccaggaccca tcagccgcgc       360
     gcaccgccgg tcgctgcctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page