(data stored in ACNUC7421 zone)

EMBL: CP001622.PE322

CP001622.PE322       Location/Qualifiers
FT   CDS_pept        complement(333700..335520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0323"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; KEGG: ret:RHE_CH00633 putative potassium-efflux
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54634"
FT                   /db_xref="GOA:C6B1B5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B5"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACS54634.1"
FT                   /translation="MPHDTPLISTIVGGLVLAFIFGAFAHRLRMPPLVGYLIAGVLVGP
FT                   HTPGYVADQNLAPELAEIGVILLMFGVGLHFSLKDLLSVRGIAVPGAIVQIAFATLLGW
FT                   GLGAFMGWPTGGSLVFGLALSVASTVVLLKALQERRLVETERGRIAVGWLIVEDLAMVL
FT                   ALVLIPAAASIGGEGHAPVEPLSAALSRLFGLDLGIGGMIAMTLVKVALFVALMLVFGR
FT                   KLIPWTMHRIAHTGSRELFRLGVLAIALGVAFGAAKLFGVSLALGAFFAGMVLAESELS
FT                   HRAAQESLPLRDAFAVLFFVSVGMLFDPNILIDKPLPILATIFIIVIGKSVAALLIVLA
FT                   FKKPLSTALTISASLGQIGEFSFILAALGVELGLLPEEGRDLILAGAIISIILNPLLFF
FT                   LCDRMRPLLDGAKREDVAADPAPAADAIAAPEEIPPEDDEVHPTALRGHAILVGYGRVG
FT                   SIVGQNLKSSATPFLVIEDSDKRIGELKAQGIETLAGNAVMRETLDLANLSGARSIAIA
FT                   IPNAFEACRIAEQARSVNPSILIVARAHSDAEVDELKQYGADTVIMGEREIALGMVDRL
FT                   AQVHHESVPYEDSHGPDTIAPTDDPPPERE"
     atgccacacg atacgccctt gatttcgaca atcgtcggcg gcctcgtgct ggctttcatc        60
     ttcggcgcct tcgcccatcg gctgcggatg ccgccgctcg tcggttatct gatcgccggc       120
     gtgctcgtcg ggccacatac gccaggttat gtggcagatc agaaccttgc gccggagctg       180
     gccgaaatcg gcgtcatcct gctgatgttc ggcgtcgggc tgcatttttc cctgaaagac       240
     ctgctgtcgg tgcgcggcat cgccgtgccc ggcgcgatcg tgcagatcgc ttttgcgaca       300
     ttgctcggct gggggctcgg cgccttcatg ggctggccga ccggcggcag cctggttttc       360
     ggcctggcgc tttcggtcgc ctccaccgtc gtgctcttga aggcgctgca ggagcggcgc       420
     ctggtcgaga ccgagcgcgg caggatcgcc gtcggctggc tgatcgtcga ggatctcgcc       480
     atggtgctgg cgctggtgct gatcccggcc gcagccagca tcggcggtga ggggcacgct       540
     cccgtcgagc cgctctcagc cgcgctcagc cgcctgttcg gcctcgatct cggcatcggc       600
     ggcatgatcg ccatgacgct ggtgaaggtg gcgctgttcg tggcgctgat gctggtcttc       660
     ggccgcaagc tcattccctg gacgatgcat cgcatcgccc ataccggttc gcgcgagctt       720
     ttccggctcg gcgtgctggc gatcgcgctc ggtgtcgctt tcggagcggc gaagctcttc       780
     ggcgtgtcgc tggcgctcgg cgccttcttt gccggcatgg tgcttgccga aagcgagctc       840
     agccatcgcg ccgcacagga aagcctgccg ctgcgcgacg ccttcgccgt gctgttcttc       900
     gtctcggtcg gcatgctgtt cgatccgaac atcctgatcg acaagccgct gccgatcctc       960
     gccaccatct tcatcatcgt catcggcaag tccgtcgccg cgctcctgat cgtgctcgcc      1020
     ttcaagaagc cgctcagtac ggcgctgacg atttcggcca gcctcggcca gatcggcgaa      1080
     ttctccttca tcctcgccgc cctcggcgtc gaactggggc tgctgccgga ggaaggccgc      1140
     gatctgatcc ttgccggcgc catcatctcg atcatcctca atccgctact gttcttcctc      1200
     tgcgaccgca tgcggccgct gctggatggt gcaaagcgcg aagacgtcgc ggcagaccct      1260
     gctcccgctg cagatgcaat agcagcgccg gaggagatac cgcccgaaga tgacgaggtg      1320
     cacccgaccg ctctccgcgg ccacgccatt ctcgtcggct acgggcgggt tggcagcatc      1380
     gtcggacaga atctcaagtc gtcagccaca ccttttctgg tcatcgagga ttctgacaag      1440
     cgcatcggcg agctgaaggc gcagggcatc gaaactctgg cgggcaatgc ggtgatgcgg      1500
     gaaacgctcg acctagccaa tctttccggc gcccgcagca ttgcgatcgc catccccaac      1560
     gccttcgagg cctgccgcat cgccgagcag gcacgcagcg tcaatccatc gatcctcatc      1620
     gtcgcccgag cccattccga cgccgaagtc gatgagctga agcaatatgg cgccgacacc      1680
     gtcatcatgg gcgagcgtga aattgcgctt ggcatggttg accggctcgc ccaagtgcat      1740
     catgagagtg tgccctatga agacagccat gggcctgata caattgcccc gacggatgac      1800
     cctccgccgg aaagagaatg a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page