(data stored in ACNUC7421 zone)

EMBL: CP001622.PE323

CP001622.PE323       Location/Qualifiers
FT   CDS_pept        335555..335854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54635"
FT                   /db_xref="GOA:C6B1B6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B6"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00634"
FT                   /protein_id="ACS54635.1"
FT                   /translation="MTYMVYIDQYGQLEIMGQGARETILTPALCRAARGLLDWTQTDLA
FT                   DRAAVSRSTIRDYEGRHHDIHRATEAQLRLAFEEGGVKFVEIQGAGTGVYLPTA"
     atgacatata tggtctatat cgaccaatat gggcaacttg aaatcatggg tcaaggcgca        60
     agagaaacaa ttctcactcc cgctctctgc cgcgcggcgc gcggcctgct cgactggact       120
     caaaccgatc ttgccgacag ggctgccgtc tcgcgcagca ccatccgcga ctatgagggc       180
     cggcaccacg acatccaccg cgcgacggaa gcgcaactgc gcctcgcctt cgaggaaggc       240
     ggcgtcaaat tcgtggagat ccaaggggca ggcaccggcg tttacctgcc gactgcataa       300
//

If you have problems or comments...

PBIL Back to PBIL home page