(data stored in ACNUC7421 zone)

EMBL: CP001622.PE324

CP001622.PE324       Location/Qualifiers
FT   CDS_pept        complement(335936..337357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0325"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="KEGG: ret:RHE_CH00635 putative glycosyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54636"
FT                   /db_xref="GOA:C6B1B7"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B7"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00635"
FT                   /protein_id="ACS54636.1"
FT                   /translation="MSPRSGLLIVLGFTLWRVVMLNFDTTDLFVDEAQYWFWSQNLDLG
FT                   YYSKPPMIAWVIRAMTELSGSNAIYWIRLLGPLIHMAAALVLMKTAKRFVGPEIEGWTG
FT                   ATYITLPGVALSSVFFSTDVILLFFIAIALLAYFGLTQRRSVGLALVMGLGVGLAFLTK
FT                   YAVLFVVPGGALALLLIPAARIAIRDFIIAVAVAAVVALPNLWWNLQHDNTTVRHTQDI
FT                   AHWSELGINLRRGLEFFAAQFGVVGPIIFFAMLWAVYRMIKGRSDDREKMLVWLSMPVV
FT                   VLITLQATVAKAYANWAVTAYVAGTILAVWLLYLKWPKGLRLSLTINGIASLLFPLATI
FT                   FPHQLLLPNGDALMKRYLGRAEVSRETAALAAQAGTDIIVTDNRDMVADLFYTLRDASY
FT                   RIYARAPAGLPESYYEQEFALPADITGKVLFLTDGAFTCATETPEVLKNWQPTEGNYKG
FT                   KTLSIYKVSAACLAP"
     atgtccccca gatctggtct cctcatcgtt cttggcttca cgctctggcg cgtcgtcatg        60
     ctcaatttcg atacgacgga ccttttcgtc gacgaggcgc agtactggtt ctggtcgcaa       120
     aacctcgacc tcggctatta ttccaagccg ccgatgattg cgtgggtgat ccgggcgatg       180
     accgagcttt ccggctccaa cgccatctat tggatcaggc tgctcggacc gctgatccac       240
     atggcggcgg cactggtgct gatgaagacg gcaaaacgtt tcgtcgggcc ggagatcgaa       300
     ggctggacgg gcgccaccta tatcaccctc ccgggcgtcg cgctgtcttc ggtgttcttc       360
     tcgaccgacg tgatcctgct gttcttcatc gcgatcgcgc tgcttgccta tttcggcttg       420
     acccagcggc gctcggtcgg gctggcgctc gtcatgggcc ttggcgtcgg cctcgccttc       480
     ctgacgaaat atgccgtgct gttcgtcgtt ccgggcggag cgcttgccct cctcctcatt       540
     ccggcggcgc gcatcgccat ccgggatttc atcatcgcgg tcgcggtcgc ggcggtcgtc       600
     gccttgccga acctctggtg gaacctgcag cacgacaaca cgacggtgcg gcatacgcag       660
     gatatcgccc attggagcga actcggcatc aatctccgtc gcgggcttga attcttcgcc       720
     gcccagttcg gcgtggtcgg gccgatcatc ttcttcgcga tgctctgggc ggtctaccgc       780
     atgatcaagg gcaggagtga cgatcgggaa aagatgctgg tctggctgtc gatgccggtc       840
     gtcgtgctca tcacgctgca ggcgacggtc gccaaggcct atgccaactg ggcggtgact       900
     gcctatgtcg ccggcaccat ccttgccgtc tggctgcttt acctgaagtg gccgaagggg       960
     ctcaggctgt cgctgaccat caacggcatc gccagcctgc tctttccgct ggcgacgatc      1020
     tttccgcatc agttgctgct gccgaacggc gacgcgctga tgaagcgcta tctcggccgc      1080
     gccgaggtca gccgcgagac cgccgcactc gcagctcagg ccggcaccga catcatcgtc      1140
     accgacaatc gcgatatggt cgccgatctt ttctacacgc tgcgcgatgc atcctacagg      1200
     atctatgcgc gggcgccggc gggccttccg gagagctatt acgagcagga attcgctctg      1260
     cccgccgaca tcaccggcaa ggtgcttttc ctgacggacg gggccttcac ctgcgccacc      1320
     gagacgcccg aggtgctgaa gaactggcag ccgacggagg gcaactacaa gggtaagaca      1380
     ctttccatct acaaggtctc tgccgcctgc ctggcaccct ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page