(data stored in ACNUC7421 zone)

EMBL: CP001622.PE326

CP001622.PE326       Location/Qualifiers
FT   CDS_pept        338186..339820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0327"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000713
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54638"
FT                   /db_xref="GOA:C6B1B9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54638.1"
FT                   /translation="MPSDQARGAQAGSLRDRLRFAGLDTDQCELVRRNRPALEAHLKAG
FT                   LRDLFHRFQSFPDASRNFESERQVERLHDLQSSHWDVLTDARFDSLYAERVKVLSDTES
FT                   KMGLDPRWHVAGHGVMLEHVVSGLAEQIAGRPLLPSAKRRTREISDLMTAIIRIVMVDV
FT                   EIAVSLRFNALRAGEQRALADQRAANEAEIIRIFGDVIEGLSARDLTRRAPVDGDGAYG
FT                   GIAAALNGALDGLQAEFTAITERTVKAEAATGSLAGLSRQFAGTASGQADRLQLSAAAL
FT                   AGIAGSVRDGAADSRAAEQAAATTRAAVEESGEVVGRAISAMADIEQSAEKIGQIIGAI
FT                   DEIAFQTNLLALNAGIEAARAGDSGRGFAVVAQEVRALAQRSAEAAREIKTLVTTTKAQ
FT                   VDAGVQMVGRTQDSIGSIVRQVTDINAAISGIATRTGEHAASLDSVTSDVKGLGGEVAD
FT                   SAGLAERSAEGADHLHSVILELGQTIREFRIARENATAGRPAPVRVTPPRALEGATRPA
FT                   PVVDEYENDDFGLPQAFASVGGGRNVY"
     atgccatcag atcaggctcg tggagcgcag gcaggcagct tgcgcgaccg cctgcgcttt        60
     gccggtctcg ataccgacca gtgcgagctg gtgcgccgta accggccggc gctcgaagcc       120
     catctgaagg cgggcctcag ggatctcttc caccgattcc agtcattccc cgacgcctcg       180
     cgcaatttcg agagcgaacg ccaggtcgag cgtctgcacg atctgcagtc ctcgcattgg       240
     gacgtgctga cggatgcgcg gttcgacagc ctctatgccg agcgcgtcaa ggttctctcc       300
     gataccgaaa gcaagatggg tcttgacccg cgctggcacg tggccggcca tggcgtcatg       360
     ctggagcatg tcgtttccgg cctcgccgag cagattgccg gccgtccgct gctgccgtcg       420
     gccaagcgcc gcacccgcga aatctccgac ctgatgacgg cgatcatccg catcgtcatg       480
     gtcgatgtgg aaattgccgt ctcgctccgc ttcaatgcgc tgcgcgccgg ggagcagcgc       540
     gcgctcgccg atcagcgcgc cgccaacgag gccgagatca tcaggatctt cggcgatgtc       600
     atcgaaggcc tgtccgcacg cgacctgaca cgccgcgcgc ctgtcgacgg cgacggcgcc       660
     tatggcggga tcgccgcggc gctgaatggc gcgctggacg gcctccaggc cgaattcacc       720
     gctattaccg agcgcacggt caaggccgaa gcggcgacag gttcgcttgc cggtctgtcg       780
     cggcagttcg ccggcacggc gtccggccag gccgatcggc tgcagctttc cgccgctgcc       840
     cttgccggca tcgccggcag tgtgcgcgat ggtgctgctg acagccgcgc tgccgaacag       900
     gcggccgcca cgacgcgcgc tgccgtcgag gaaagcggtg aagtcgtcgg ccgcgcgatc       960
     agcgccatgg ccgatatcga gcagtcggcc gaaaagatcg gccagatcat cggggcgatc      1020
     gacgagatcg ccttccaaac caatcttctg gcgctgaatg ccggcatcga agccgcgcgc      1080
     gccggcgatt ccggccgcgg ttttgccgtc gtcgcccagg aagtccgcgc ccttgcccag      1140
     cgttcggccg aagccgcccg cgagatcaag acgctggtga cgacgaccaa ggcgcaggtc      1200
     gacgctggcg tgcagatggt cggccgcaca caggattcga tcggcagcat cgtgcgccag      1260
     gtcaccgaca tcaacgccgc catatcaggc atcgccaccc gaaccggcga acatgccgca      1320
     agcctcgaca gcgtgacatc agacgtcaag ggcctgggtg gcgaggtggc cgatagcgcc      1380
     ggccttgcgg agcgctcggc cgaaggcgcc gaccacctcc acagcgtcat tctcgagctc      1440
     ggccagacga ttcgcgaatt ccgcatcgcc cgggaaaacg ccactgccgg gcgccctgcg      1500
     ccggtgcgcg tgacaccgcc gcgggccctt gagggcgcta cccgcccggc accggtcgtg      1560
     gacgaatacg aaaatgacga ttttggcctt ccgcaagcgt tcgcaagcgt cggaggtggg      1620
     cggaatgttt actaa                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page