(data stored in ACNUC7421 zone)

EMBL: CP001622.PE327

CP001622.PE327       Location/Qualifiers
FT   CDS_pept        339884..340180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0328"
FT                   /product="chemotaxis protein CheX"
FT                   /note="KEGG: rec:RHECIAT_CH0000714 chemotaxis protein CheX"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54639"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000714"
FT                   /protein_id="ACS54639.1"
FT                   /translation="MAAKKSGKTLDLTAVLDLNEASALRDKLLSLRGSGLSIDASGVER
FT                   IGALCAQVLMSAEKTWEQDKQPFTFSKVSDAFQKTMQLVGVNIDHLLAKEIRQ"
     atggcagcaa agaagagtgg caaaacgctg gatttgacag cggtgctcga cctcaacgag        60
     gcttccgcct tgcgcgataa actcctctcc ctccggggta gcggtctttc gatagacgct       120
     tccggcgtcg aacggatcgg cgcgctttgc gcccaggttc tgatgtccgc cgagaagacc       180
     tgggagcagg acaagcagcc gttcaccttc tccaaggtgt ccgacgcatt tcagaaaacc       240
     atgcagctgg ttggcgtcaa tattgaccac ctgcttgcca aggagattcg gcaatga          297
//

If you have problems or comments...

PBIL Back to PBIL home page