(data stored in ACNUC7421 zone)

EMBL: CP001622.PE328

CP001622.PE328       Location/Qualifiers
FT   CDS_pept        340177..340542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0329"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000715 chemotaxis
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54640"
FT                   /db_xref="GOA:C6B1C1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54640.1"
FT                   /translation="MKKKVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLEES
FT                   NPDVIVTDINMPRLDGFGFIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIV
FT                   KPFDPAKLIDAIERVTA"
     atgaagaaaa aagtgctgac cgtggatgat tcccgcacca tccgaaacat gcttctcgtg        60
     acactgaaca atgctggctt cgagacgatc caggcggaag acggcatcga gggccttgag       120
     gttctcgaag agtccaatcc cgacgtcatc gtgaccgaca tcaacatgcc gcgcctcgac       180
     ggtttcggct tcatcgaagg tgtccgccgc aacgagaaat atcgggcgat cccgatcctg       240
     gtcctgacca cggaaagcga cgcggaaaag aagaaccgtg cccgccaagc cggtgccacg       300
     ggctggatag tcaagccttt cgacccggcc aagctgatcg atgccattga gcgtgtaacc       360
     gcttaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page