(data stored in ACNUC7421 zone)

EMBL: CP001622.PE329

CP001622.PE329       Location/Qualifiers
FT   CDS_pept        340560..342836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0330"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000716 chemotaxis two-component
FT                   sensor histidine kinase protein; PFAM: ATP-binding region
FT                   ATPase domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; CheW domain protein;
FT                   SMART: CheW domain protein; Hpt domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54641"
FT                   /db_xref="GOA:C6B1C2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C2"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACS54641.1"
FT                   /translation="MDMNEIKEIFFQECEEQLAELESGLLKMNDGDRDPETVNAVFRAV
FT                   HSIKGGAGAFGLDDLVAFAHVFETTLDCVRSNKLEPNQDVLKVMLKSADVLADLTNVAR
FT                   DGGSVDESRSRGLVRELEALANGEMPSPSASVEAPAPKAAAKAAPAPTPKPTDDSGFQP
FT                   VPFSFDDFGGEGDAGGMPAYEVIFKPRYELYSKGNDATLLLRDLSRLGEMTIYCNTDDL
FT                   PGLEELDPEGAYFFWNVTIKTDKGEDAIRTVFEFAEWDCELTVKPVEEARAEATSNDEL
FT                   PMVPVPFDLSILDEAGAIEEVSASDARAEETAAAVAAAETASNVTQIVAARVEKKESAA
FT                   AAAAAASAAAQNNAAGAGQTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTTGTSS
FT                   INMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSIRLITEGENTE
FT                   VDKTVIDKLAEPLTHMIRNAVDHGIETPEKRAAAGKNTEGTVRLTAKHRSGRILIELAD
FT                   DGAGINREKVRQKAIDNDLIPADSNLSDEEIDNLIFLPGFSTADKISDISGRGVGMDVV
FT                   KRSIQALGGRINITSKPGHGSVFTMSLPLTLAVLDGMVVTVAGQTLVVPLTAIVETLQP
FT                   EAAAIHSFGANHRLISIRNSFCPLVDVGRILNFRATQANPVEGVALLVESEGGGQRALM
FT                   VDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAVVGASRGQSLKAEMS
FT                   LAAVG"
     atggatatga acgaaatcaa agagatcttt ttccaggagt gcgaggaaca gctcgcagaa        60
     ttggaatccg gtcttctgaa aatgaatgat ggcgatcgcg atccggaaac cgtcaatgcg       120
     gtgttccgtg ccgtgcattc gatcaagggc ggcgccggcg ccttcggcct tgacgatctg       180
     gtagccttcg cccatgtttt cgagaccact ctcgattgcg ttcgatccaa caagcttgag       240
     ccgaaccagg acgtcctgaa ggtgatgctg aagtcggccg acgtgctcgc tgacctgacg       300
     aacgttgcgc gcgacggcgg cagcgtcgat gaaagccgca gccgcggcct cgtcagggag       360
     ctcgaggcgc tggccaacgg tgaaatgccg tctccctcgg cgtcagtcga ggcgcctgcg       420
     ccgaaggcag ccgcaaaggc cgctccggcg ccgaccccca agccgacgga cgacagcggc       480
     ttccagccgg tccccttttc cttcgacgat tttggcggcg agggcgatgc cggcggcatg       540
     ccggcctatg aagtcatctt caagccgcgc tacgaactct attccaaggg caatgacgcc       600
     accctgctgc tgcgcgatct ctcgcgcctc ggcgaaatga cgatctattg caatacggat       660
     gacctcccgg gcctcgagga gctcgatccg gaaggcgctt atttcttctg gaatgtcacg       720
     atcaagacgg acaagggcga ggacgccatc cgcaccgtct tcgaattcgc cgagtgggat       780
     tgcgaactga cggtaaagcc ggtcgaagaa gcaagggccg aggcgaccag caacgacgaa       840
     ctgccgatgg tgccggttcc tttcgacctg tcgatcctgg acgaagccgg cgcaatcgaa       900
     gaggtttccg cctcagacgc gcgggccgag gagacggccg cagccgttgc cgcagccgag       960
     actgcctcca acgtcacgca gattgtcgcc gcccgcgtag agaagaagga atcggccgcc      1020
     gccgcagcgg ccgcagcaag tgctgccgct cagaacaatg ccgccggtgc cggccagacg      1080
     atccgcgtcg atctcgaccg tgtcgaccgc ctcatcaacc tcgtcggcga attggtcatc      1140
     aaccaggcga tgctgtcgca gagcgtcatc gagaacgaca cgaccggcac ctcctcgatc      1200
     aatatgggcc tcgaggagct gcagcagctc acccgcgaga tccaggactc ggtcatggcg      1260
     atccgcgcgc agccggtgaa gccggtcttc cagcgcatgt cgcgtatcgt ccgcgaaatc      1320
     gccgacatga ccggcaagtc gatccgcctg atcaccgaag gtgaaaacac cgaagtcgac      1380
     aagacggtca tcgacaagct ggccgaaccg ctgacccaca tgatccgcaa cgccgtcgac      1440
     cacggcatcg aaacgcccga aaagcgtgca gccgccggca agaacaccga aggcactgtc      1500
     cgcctgaccg ccaagcatcg ttcgggacgc atcctgatcg agcttgccga cgacggtgcc      1560
     ggtatcaacc gcgagaaggt ccgccagaag gcgatcgaca acgacctcat cccggccgat      1620
     tccaacctgt cggacgagga aatcgacaac ctgatcttcc tgccgggctt ctcgacggcc      1680
     gacaagatct ccgacatctc cggccgcggc gttggcatgg acgtcgtcaa acgttcgatc      1740
     caggcgctcg gcggccgcat caacatcacc tcgaagccgg gtcacggctc ggtcttcacc      1800
     atgagcctgc cgctgacgct cgccgtcctc gacggcatgg tagtcactgt cgccggccag      1860
     acgctggtcg tgccgctgac ggcgatcgtc gaaaccctgc agccggaagc ggccgcgatc      1920
     cactccttcg gtgccaacca ccggctgatc tcgatccgca acagcttctg cccgctggtc      1980
     gatgtcggcc gcatcctgaa cttccgcgcc acccaggcca atccggtcga gggcgtggcg      2040
     cttctggtgg aatccgaagg cggcggccag cgcgccctga tggtcgatgc catccagggt      2100
     cagcgccagg tggtcatcaa gagcctggaa gcgaactaca cccatgtgcc gggcattgcc      2160
     gccgccacca tcctcggtga cgggcgcgtc gctctcatcc tcgatgtcga cgcagtcgtc      2220
     ggcgcctcgc gcggccagtc gctcaaagcg gaaatgtcgt tagcagcggt gggataa         2277
//

If you have problems or comments...

PBIL Back to PBIL home page