(data stored in ACNUC7421 zone)

EMBL: CP001622.PE33

CP001622.PE33        Location/Qualifiers
FT   CDS_pept        complement(31568..32062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0034"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000419 ribosomal-protein-alanine
FT                   N-acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54345"
FT                   /db_xref="GOA:C6AYC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS54345.1"
FT                   /translation="MLEAYLTLKPEFEIIAMEREDCRDVAILHGERFARPWGDGEFHGL
FT                   LMQDTVFGFVARQTNAILKKPLPGFILARHVAGEAEILTIAVQAKVARAGLGWRLMQAA
FT                   MREARSRGGESMFLEVDNGNTAALGLYRKLGFEKVGERQGYYKQENGALSTALVMKRVL
FT                   R"
     atgctggaag cctatctgac gctgaaaccg gaattcgaga tcatcgccat ggagcgcgag        60
     gattgccgcg atgttgccat cctgcacggc gagcgcttcg cccgcccctg gggcgacggt       120
     gaatttcacg gcctgctgat gcaggatacc gtgttcggct tcgtcgcgcg ccagaccaat       180
     gccatcctga aaaagccgct tccggggttc atccttgccc gccatgtcgc cggcgaagcg       240
     gagatcctga cgattgccgt gcaggcgaag gtcgcccgtg ccgggcttgg ctggcggctg       300
     atgcaggcgg cgatgcggga agcgcggtcg cgcggcggcg agagcatgtt tctcgaggtc       360
     gataacggca atacggcagc gcttggcctc taccgcaagc tcggcttcga aaaggtcggc       420
     gaacgtcagg gttattacaa acaagaaaac ggcgccctct ccacggcgct tgtcatgaag       480
     cgcgttcttc ggtag                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page