(data stored in ACNUC7421 zone)

EMBL: CP001622.PE330

CP001622.PE330       Location/Qualifiers
FT   CDS_pept        342841..343308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0331"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: rec:RHECIAT_CH0000717 chemotaxis signal
FT                   transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54642"
FT                   /db_xref="GOA:C6B1C3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C3"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACS54642.1"
FT                   /translation="MSYTVKNLNEGDRELIAFRIGDQEFCVNIMSVREIRGWTPATAMP
FT                   HSPGYMLGVINLRGAVLPIIDLAARLGMKPADPTARHVIIVAQVRRKVVGLLVDAVSDI
FT                   LTVTDETIQPTPEISSELERQFARGILAIEKRMICLIELESLFPETESEAA"
     atgtcgtaca ctgtaaaaaa tctgaacgag ggggatcgcg agctgatcgc gttccgcatc        60
     ggggatcagg aattttgcgt gaacatcatg tcggttcgcg aaatccgcgg ctggaccccg       120
     gcgaccgcga tgccgcattc gcctggctat atgctgggtg tcatcaacct gcgcggcgcg       180
     gtgctgccga tcatcgatct tgcggcccgg ctcggcatga agccggccga tccgactgcc       240
     cgtcatgtca tcatcgtcgc ccaggtccgg cgtaaggtcg tcggcctgct ggtcgacgcc       300
     gtttccgata tcctgacggt gaccgacgaa accatccagc cgacgcccga gatctcctcc       360
     gagctcgagc gtcaatttgc ccgcggcatt ctcgccatcg agaagcgcat gatctgcctg       420
     atcgaactcg aatccctctt tccagagacc gaaagcgaag ccgcatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page