(data stored in ACNUC7421 zone)

EMBL: CP001622.PE331

CP001622.PE331       Location/Qualifiers
FT   CDS_pept        343305..344213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0332"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: rec:RHECIAT_CH0000718 methyl-accepting
FT                   chemotaxis protein O-methyltransferase protein; PFAM: MCP
FT                   methyltransferase CheR-type; SMART: MCP methyltransferase
FT                   CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54643"
FT                   /db_xref="GOA:C6B1C4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C4"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ACS54643.1"
FT                   /translation="MSVMGAKDQRQGSDEVLASGEYPLTRRDLTEIAAMIYSDAGIFLN
FT                   ETKASLVYSRLSKHIRNLGLSGFREYCDLVASPAGAAPRREMLSHLTTNFTRFFRENHH
FT                   FDHLRDHVLPELLQRARSGGRVRIWSAASSDGQEPYSIALTVLSLMPNVADYDFKILAT
FT                   DIDPKILAIARAGAYDESALETVSPAMRKQWFSEVEIQGRRKFQVDDRVKRLITYNELN
FT                   LMAQWPFKGKFDVIFCRNVVIYFDEPTQMKIWQRFAGLLPEGGHLYIGHSERVSGEAKH
FT                   VFDNIGITTYRYTSKGLGRKA"
     atgagtgtaa tgggcgcaaa agatcagaga cagggatccg acgaggtcct ggcgagcgga        60
     gaatatccgc tgacgcgccg cgacctcact gaaatcgccg caatgatcta ttcggatgcc       120
     ggcatcttcc tcaacgaaac gaaggcgtcg ctcgtctatt cgcgcctgtc gaagcatatc       180
     cgcaatctcg gcctgtccgg cttccgggaa tattgcgacc tcgtcgcttc gccggccggt       240
     gctgcgccgc gccgcgagat gctttcgcat ctgacgacca attttactcg cttcttccgc       300
     gaaaaccatc atttcgatca cctgcgcgac catgtcctgc cggagcttct gcagcgggcg       360
     agatcgggcg gcagggtacg catctggtcg gccgcctctt ccgacgggca agaaccctat       420
     tcgatcgcgc tgacggtgct gtcgctgatg ccgaacgtcg ccgattacga cttcaagatc       480
     ctggcgaccg acatcgaccc gaagatcctc gcgatcgccc gcgccggcgc ctatgacgag       540
     agcgcgctcg aaaccgtatc gcccgccatg cgcaaacaat ggttcagcga agtcgagata       600
     cagggccgcc ggaagttcca ggtcgacgac cgcgtcaagc ggctgatcac ctacaacgag       660
     ctgaacctga tggcgcaatg gccgttcaag ggcaagttcg acgtcatctt ctgccgcaac       720
     gtcgtcatct atttcgacga gccgacgcag atgaagatct ggcagcgttt cgccggcctg       780
     ctgccggagg gcggtcatct ttatatcggt cattccgagc gtgtttcggg tgaggcaaaa       840
     cacgtcttcg acaatatcgg catcacgacc tatcgctaca cgtccaaagg tctcgggagg       900
     aaggcatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page