(data stored in ACNUC7421 zone)

EMBL: CP001622.PE332

CP001622.PE332       Location/Qualifiers
FT   CDS_pept        344210..345253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0333"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="KEGG: rec:RHECIAT_CH0000719 chemotaxis-specific
FT                   methylesterase protein; PFAM: CheB methylesterase; response
FT                   regulator receiver; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54644"
FT                   /db_xref="GOA:C6B1C5"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C5"
FT                   /inference="protein motif:PRIAM:3.1.1.61"
FT                   /protein_id="ACS54644.1"
FT                   /translation="MSAPARVLVVDDSPTMRGLITAVLSSDPEVNVIGQAGDALEAREA
FT                   IKRLNPDVLTLDIEMPNMNGLDFLEKIMTLRPMPVIMVSTMTHRGAEATLAALEIGAFD
FT                   CVGKPAPGELRPFGDLAEKVKAAARTQRQYSQPVAAVAPPPSVGDFRVGRKIVAIGSST
FT                   GGVEALIAVLQKFPANCPPTVITQHMPPTFTKSFAERLNRLCAPVVQEATDGARLEIGK
FT                   IYLAPGGERHLQVSNASAPCCRLIDRAPVNGHRPSVDVLFDSVAELAGRNAVGVILTGM
FT                   GRDGAAGLLKMRHAGARTLGQNEKTCVVYGMPRVAHELGAVEQQLPLSAIGEEILKMTA
FT                   ARKEGTE"
     atgagcgctc cggcaagggt tctcgttgtt gacgactcgc cgacgatgcg ggggctgatc        60
     accgccgtct tgagttccga ccccgaggtc aacgtcatcg gccaggccgg cgacgcgctg       120
     gaagcgcggg aggcaatcaa gcggctgaac cccgacgtcc tgacgctcga catcgagatg       180
     ccgaacatga acggtctcga tttcctcgaa aagatcatga cgctgcggcc gatgcctgtc       240
     atcatggtat ccacaatgac ccatcgcggc gccgaggcga cgcttgcggc gctggagatc       300
     ggcgcgttcg actgtgtcgg caagccggcg ccgggcgaac tcaggccgtt tggcgacctc       360
     gccgagaagg tcaaggccgc cgcgcgcacg cagcgccaat attcccagcc cgtcgccgcc       420
     gtcgcgccac cgccctcggt tggcgacttc cgcgtcggcc gcaagatcgt cgcgatcggc       480
     tcgtccaccg gcggcgtcga ggcgctgatc gccgtgctgc aaaagtttcc ggcgaattgc       540
     ccgccgaccg tcatcaccca gcatatgccg ccgaccttca ccaagagctt cgccgaacgg       600
     ctgaaccgcc tctgtgcgcc ggtggtgcag gaagcgaccg acggtgcccg tctcgaaatc       660
     ggcaagatct atctggcgcc cggcggcgag cgtcacctcc aggtcagcaa cgcctcggca       720
     ccatgctgcc gactcattga ccgggcaccg gtcaacggtc accgcccctc ggtggacgtg       780
     ctattcgatt cggtcgctga actggcgggc cgtaatgccg tcggcgtgat tttgaccgga       840
     atgggccgcg atggcgccgc cggattgttg aaaatgcgcc acgccggcgc cagaacgctc       900
     ggccagaacg aaaaaacctg tgtcgtttac ggaatgccaa gggttgccca cgaacttggc       960
     gccgttgagc agcagctgcc gctgtctgcc attggtgaag aaatattgaa aatgacagcc      1020
     gcccgaaagg aagggaccga ataa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page