(data stored in ACNUC7421 zone)

EMBL: CP001622.PE333

CP001622.PE333       Location/Qualifiers
FT   CDS_pept        345254..345643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0334"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000720 chemotaxis
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54645"
FT                   /db_xref="GOA:C6B1C6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54645.1"
FT                   /translation="MSIAEKIKVLIVDDQVTSRLLLSDALTQLGFKQITSAGDGEQGMK
FT                   IMAEQPHHLVISDFNMPKMDGIGFLQAVRTNPNTKKAAFIILTAQGDRALVQKAAQLGA
FT                   NNVLAKPFTIEKMKAAIEAVFGALK"
     atgtcgatcg cggagaaaat caaagttctg atcgtcgacg atcaggtaac gagccggttg        60
     ctgctcagcg acgcgctgac ccagctcggt ttcaagcaga tcacctcggc cggtgacggt       120
     gagcagggca tgaagatcat ggccgagcag ccgcaccacc tggtgatctc ggacttcaac       180
     atgccgaaga tggatggcat cggcttcctt caggccgtgc gcaccaaccc gaacaccaag       240
     aaggcggcct tcatcatcct gaccgcccag ggcgaccgcg cactggtgca gaaggcggcc       300
     cagctcggcg ccaacaacgt gctcgccaag ccgttcacga tcgagaagat gaaagcggcc       360
     atcgaagccg tgtttggagc cctgaaatga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page