(data stored in ACNUC7421 zone)

EMBL: CP001622.PE334

CP001622.PE334       Location/Qualifiers
FT   CDS_pept        345640..346194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0335"
FT                   /product="CheD, stimulates methylation of MCP protein"
FT                   /note="PFAM: CheD family protein; KEGG:
FT                   rec:RHECIAT_CH0000721 chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54646"
FT                   /db_xref="GOA:C6B1C7"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C7"
FT                   /inference="protein motif:PFAM:PF03975"
FT                   /protein_id="ACS54646.1"
FT                   /translation="MITEGAARRVHIIQGEYKVLNDPNAVLSTILGSCVAACLRDPVAG
FT                   VGGMNHFLLPGSATSPTSGGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAKTIS
FT                   TFSNVGEQNAAFAVQFLRDEGIPVVGSSTGGEHGRKLEYWPVSGRARQYPLTGAETQRT
FT                   VALEQRPAAPQKPVETSIEFF"
     atgatcactg agggggcagc ccgccgcgtg cacatcattc agggcgagta caaggttctg        60
     aacgatccga atgcggtcct ctcgaccatt ctcggttcgt gcgtggctgc gtgcctcaga       120
     gatcctgtcg ccggtgtcgg cggcatgaac cactttctgc tgcccggttc ggcgacgtcg       180
     ccgacatcag gcggcgatgc cacgcgctac ggcgtgcatc tgatggaact gctgatcaac       240
     ggtctcttga agcagggcgc ccggcgcgac cggctggaag caaaaatctt cggcggcgcg       300
     aagacgatct cgacattctc caatgtcggt gagcagaacg cggccttcgc cgtgcagttc       360
     ctgagggatg aaggcattcc ggtggtcggt tcctcgaccg gcggagagca tggacgcaag       420
     cttgaatatt ggccggtctc cggtcgtgcc cggcaatacc ctctgaccgg cgccgaaacg       480
     cagagaaccg tcgctctcga gcagcgtccc gccgctccgc agaaacccgt cgaaaccagt       540
     atcgaatttt tttga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page