(data stored in ACNUC7421 zone)

EMBL: CP001622.PE335

CP001622.PE335       Location/Qualifiers
FT   CDS_pept        346211..346600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54647"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C8"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00645"
FT                   /protein_id="ACS54647.1"
FT                   /translation="MTFTQMMETPAPVEALSDILMRIVSELHDVAYLIERIEPQLLDLG
FT                   SAEILNSPDAMKVMQGIDLAVQKSRGLAEFIDTITGEIPHGWAVDVATALSLVKLAEMQ
FT                   KALGGATRHGHSQPLSKAAGDFDFF"
     atgacattta cccagatgat ggaaacgccc gcgcctgtcg aagcgctgag cgacatcctg        60
     atgcgcatcg tgtccgaact gcacgatgtc gcctacctca tcgaacgcat cgagccccag       120
     cttctcgacc tcggcagcgc cgaaatcctg aactcgccgg atgccatgaa ggtcatgcag       180
     ggcatcgatc tggccgtgca gaaatcacgc ggccttgccg aattcatcga caccatcacc       240
     ggcgaaatcc cgcacggctg ggcagtcgac gtcgcaaccg cgctcagcct cgtcaaactg       300
     gcagagatgc agaaggcatt gggcggggcc acacgccacg gccattccca gccattgagc       360
     aaggcagccg gcgacttcga tttcttctag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page