(data stored in ACNUC7421 zone)

EMBL: CP001622.PE336

CP001622.PE336       Location/Qualifiers
FT   CDS_pept        346810..348501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0337"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring domain protein; KEGG: rec:RHECIAT_CH0000723
FT                   flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54648"
FT                   /db_xref="GOA:C6B1C9"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C9"
FT                   /inference="protein motif:TFAM:TIGR00206"
FT                   /protein_id="ACS54648.1"
FT                   /translation="MNLLNQLVQIFKNFGSLGRTRLMILGGVGAVSIAIVLAAALFVNK
FT                   PAQETLYVGLDSPDLNQISMALAEANINFQVGTDGTSISVPAGMTGKARLMLAERGLPN
FT                   SANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNF
FT                   RKAEQKPTASVMIRASATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEA
FT                   SNSSLNRSLNIVQNVQQEVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPE
FT                   SKVERSVRSTKEAQQSQQKQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNY
FT                   EINSKTTATTRSSYKVEKLSIAVVVNKGRIAKMVGEPADQTKVDAYLAEMQKIVASAAG
FT                   IDAKRGDVVTVTAMDFLENQLLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFLVVWMG
FT                   LRPLVRSVSGNGSSAAFGDATPEAAGLELPDFAPASGAPGGALMDGFGSDFGFDSTEDL
FT                   LSLGDDDGNFNRRVKEGPERKLSRMVEINEERAAKILRKWAIDEAA"
     atgaatctgt taaatcaatt agttcagatc tttaagaact tcggttccct tggccgaaca        60
     cgcctgatga ttctgggagg cgtcggtgcc gtttccattg caatcgtcct tgcggccgct       120
     cttttcgtca acaagccggc acaggaaaca ctctatgtcg gtctggattc gcccgatctc       180
     aaccagatca gcatggcgct tgccgaagcc aacatcaatt tccaggtcgg caccgacggc       240
     accagcatca gcgttcccgc tgggatgacg ggcaaggccc gcctgatgct tgccgagcgc       300
     ggcctgccga acagcgccaa tgccggttac gaactctttg acaatgtcgg ctccctcggc       360
     ctgacctcct tcatgcagga ggtgacgcgg gttcgagcgc tggaaggcga aatcgcccgc       420
     accatccagt cgatctcggg tataacagcc gcgcgcgtcc atatcgtcat gccggaggtt       480
     ggaaacttcc ggaaggcgga gcagaaaccg accgcatccg tcatgattcg cgcaagcgct       540
     accaccgggc gcagcgcggc gacctcgatc cgccacctcg tcgcctcggc cgtgccgggg       600
     cttgacgtcg atgacgtcac catcctcgat tccgccggcc agctcctcgc ttccggcgac       660
     gaggcgagca acagctcgct gaaccgctcg ctcaacatcg tccagaacgt tcagcaggaa       720
     gtcgaatcca acatcgacaa ggcgctggca cccttcctcg gcatggacaa cttccgttcc       780
     agcgtcaccg ccgatctcaa caccgacgcc cagcagatcc aggaaacgac ctacgatccc       840
     gaatccaagg tcgaacgttc ggtccgctcg accaaggaag cccagcagtc gcagcagaag       900
     cagtccgata gcgcgacgac ggtcgagcag aacattccgc aggcggctcc cgaggccggc       960
     ggctccgccg ggcccgaatc gcaagacaag tccgacaagc gcgaagagca gaccaactac      1020
     gaaatcaaca gcaagacgac ggcgacgacc cgcagcagct ataaggtcga aaagctttcg      1080
     atcgccgtgg tggtcaacaa gggccgcatc gccaagatgg tcggtgagcc cgccgaccag      1140
     acaaaggtcg acgcctatct cgccgaaatg cagaagatcg tcgcctcggc ggccggcatc      1200
     gacgccaagc gcggcgacgt cgtcaccgtc acggcgatgg acttcctcga aaatcagctg      1260
     ctcgaagacg ccaccggtgg tgtccgcgtc atggatatgc tgagccgcaa tctggccggc      1320
     atcatcaact cgctcgcctt tgtcgcggtc gccttcttgg tggtctggat gggcttgcgg      1380
     ccactggtgc gcagcgtcag cggcaacggc agctctgcgg ctttcggcga cgcgacgccg      1440
     gaagcggccg gcctcgagct tccggacttc gcgcctgcat cgggagcacc cggaggcgct      1500
     ctcatggacg gcttcgggtc cgacttcggc ttcgacagta ccgaggacct gctcagcctc      1560
     ggcgacgacg atggaaactt caatcggcgc gtcaaggaag gcccggaacg caagctttcc      1620
     cgtatggtcg agatcaacga ggaacgcgcc gcgaaaatcc tcaggaaatg ggcgatcgac      1680
     gaagcagcgt aa                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page