(data stored in ACNUC7421 zone)

EMBL: CP001622.PE337

CP001622.PE337       Location/Qualifiers
FT   CDS_pept        348947..349693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0338"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Bacterio-opsin
FT                   activator HTH domain protein; SMART: regulatory protein
FT                   LuxR; KEGG: rec:RHECIAT_CH0000724 probable transcriptional
FT                   regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54649"
FT                   /db_xref="GOA:C6B1D0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D0"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54649.1"
FT                   /translation="MDMNVIQASKGERQMANFASAAVPDLLPRDELLQRLHGVASTGRL
FT                   QSGLRALTDYVGASYYLLARCDLLQESGLDFIVSSDWPFDLVRDIANDLVRGYARSTEL
FT                   EKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNVGRSRLALMFLFGEGFILSPERLRD
FT                   VGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWIAEGKTSDEIAMILGISRNTINNY
FT                   ITSVMRKTATKTRSEAIAFAVRNNLV"
     gtggatatga atgtaattca ggcgagcaaa ggcgagaggc agatggcgaa tttcgcgagt        60
     gcggcggtgc cggatctgtt gccgcgtgat gagctgctcc agcgcctcca cggcgtcgcc       120
     agcaccggca ggttgcagtc tggtctgcgc gcactgacgg actacgtggg tgcttcgtac       180
     taccttctgg cgcgctgcga tctcctccag gaaagtggcc tcgatttcat cgtttcgtct       240
     gactggcctt tcgacctggt cagggacatc gccaatgatc tggtccgcgg ctatgcccgg       300
     tcgaccgagc tggaaaaatg catgcaggtc ttccagccga attttgctct tctgcctgac       360
     agtgccgagg tcccggatgg cgccagccgc caatattgtt cggtgacctt caatgtcggc       420
     cggtcgcggc tggccttgat gttcctgttc ggggagggat tcatcctttc gccggagcgc       480
     ctgcgcgatg taggcttgct tgcaggttat gtcgcgagct tccttcgctg cggcggtacg       540
     aaggtcgatc gcgatttcga attgaccgac cgcgagctgg aatgcctgtt ctggatcgcc       600
     gagggcaaga ccagcgacga gatcgcgatg attctcggaa tatcccgcaa taccatcaac       660
     aactacatca ccagcgtgat gcgcaagacg gcgaccaaga cccggtccga ggccattgcc       720
     ttcgccgtcc gcaataatct cgtatag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page