(data stored in ACNUC7421 zone)

EMBL: CP001622.PE338

CP001622.PE338       Location/Qualifiers
FT   CDS_pept        349702..350448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0339"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: rec:RHECIAT_CH0000725 probable
FT                   transcriptional regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54650"
FT                   /db_xref="GOA:C6B1D1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54650.1"
FT                   /translation="MGYPSGRTMSSAEQLRMVRVNRISSRSDLFPRLIAMQKLADAQGF
FT                   AIFRVSGSGIPAKQRLVCELENWGSSNAGFGKAFTDAYGDILLDHIDKSLLPLSWAGGY
FT                   DRAAPGPADFSPFMTRLQDGILPFSGLAFPVRLGAVGNGFILFTGDEIDPSSDTIVELH
FT                   GRCCHIMMDLLSLDERRTAAAEALSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYL
FT                   GSATIKLDSVNRIQAIAKAIRLGYIS"
     atggggtatc catcaggcag gaccatgagc agcgccgagc agctgcgaat ggtacgtgtg        60
     aacaggattt ccagccggtc cgatcttttt ccgcggctga tcgcgatgca gaagctcgcc       120
     gatgcgcaag gcttcgcgat cttccgcgtc agcggctcgg gcattccggc aaagcagcgg       180
     cttgtctgcg agctcgagaa ctgggggtct tccaatgccg gtttcggcaa ggccttcacg       240
     gatgcctacg gcgatattct tctcgaccat atcgacaagt cgctgctgcc gctctcatgg       300
     gcaggcggtt acgaccgtgc ggcacccggt ccggcggact tctcgccgtt catgacgcgg       360
     ctgcaggacg gtattctgcc tttctccgga cttgcctttc cggtgcggct tggcgccgtc       420
     ggcaacggtt tcatcctttt caccggcgat gagatcgatc cttcgagcga taccatcgtc       480
     gagctgcacg gtcgatgctg ccatatcatg atggatctgc tctcgctcga cgagcgccgc       540
     acggcggctg ccgaggcgct cagcgaacgc gagatcgcct gtctgcaatt ggccggcgac       600
     ggccgcatca gcgaagagat tgccgacaag ctcggcctgt ccgtgcacac cgtgaacgcc       660
     tatctcggct cggcgaccat caagctcgat tccgtcaatc gcatccaggc gatcgccaag       720
     gcgatccggc tcggttatat cagctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page