(data stored in ACNUC7421 zone)

EMBL: CP001622.PE339

CP001622.PE339       Location/Qualifiers
FT   CDS_pept        complement(350561..351004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54651"
FT                   /db_xref="InterPro:IPR017024"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000726"
FT                   /protein_id="ACS54651.1"
FT                   /translation="MKKCPHSTQREKILADAISPVATELRLLDASDLISLLRFEYYGNL
FT                   SDLVASAAELFFHPGTVNFGLGGNYTLEWGGKPEVVLDLEIKPRGVTVYAQLTLAEDHA
FT                   GIEINHIAFQNPSADPDENTIFLRRSLRESRYSINQPPQTLAG"
     atgaaaaaat gccctcactc tacccagcgt gaaaagatcc tcgcagacgc gatcagcccg        60
     gtcgctactg aactgcgcct tctggatgct tctgacctta tttcactgct gcgcttcgag       120
     tattacggca acctttccga tctcgtcgct tcggcggcgg agcttttctt tcatccgggc       180
     acggtgaact tcggcctggg cggcaattat actctggaat ggggcggcaa gcccgaagtc       240
     gttctcgatc tggaaatcaa gccacgcggt gtcaccgtct acgcacagct cacccttgcc       300
     gaagaccacg ccggcatcga gatcaatcat atcgccttcc agaacccctc ggcggatcct       360
     gacgagaaca ccatattcct cagaagaagc cttcgggaat cgcgttacag catcaaccag       420
     ccgcctcaga cgctggccgg ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page