(data stored in ACNUC7421 zone)

EMBL: CP001622.PE34

CP001622.PE34        Location/Qualifiers
FT   CDS_pept        complement(32065..32727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0035"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   ret:RHE_CH00380 O-sialoglycoprotein endopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54346"
FT                   /db_xref="GOA:C6AYC2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC2"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ACS54346.1"
FT                   /translation="MIILALDTAGVDCAAAVFDSGRNTVLGEASDMIGKGHAEHLIGIV
FT                   DRALDQAGLALSDVDRLAVTIGPGSFTGIRVGVAAARGFALSLNVPAVGITTLEVMASA
FT                   QRDKTPHRAVLAAMDAKRDEIYLQSFAADGSPLDAPRAVSVAQAQAFAAGFDGEITGSA
FT                   TPLLKADAGGDHTNRFPISIVARLGAAASPDSGKPKPLYLRGPDAKPQAGYAIARRV"
     atgatcattc tggcgctcga cacggcgggt gtggactgcg ctgccgccgt ctttgacagc        60
     ggtaggaata cggtgctggg ggaggcatcg gacatgatcg gcaaggggca tgctgaacat       120
     ctgattggta tcgtcgatcg cgcactcgat caggcgggac tggccctttc ggatgtcgac       180
     cgccttgccg tcaccatcgg tcccggctcc tttaccggga tccgtgtcgg cgttgccgca       240
     gcccgcggtt ttgcgctctc tctgaatgtg ccggccgttg gcatcaccac gcttgaagtc       300
     atggcatcag cccagcgcga caagacgcct catcgcgccg tgctggcggc gatggatgcc       360
     aagcgggacg aaatctacct ccagtccttc gcagccgacg gttcgcccct cgacgcgcca       420
     cgggcagtca gcgttgcgca agcgcaggct tttgccgccg gcttcgacgg cgagattacc       480
     ggttcggcga cgcccctcct caaggccgac gccggcggcg atcataccaa cagattcccg       540
     atctccatcg tggcgcgcct gggcgctgcc gcctcccccg attccggaaa gccgaagccc       600
     ctttatctgc gcggacccga tgccaagccg caggccgggt acgcaattgc gcgacgagta       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page